VAMP3/Cellubrevin Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• VAMP3/Cellubrevin Polyclonal antibody, PBS Only (10702-1-PBS)

• 

  WB analysis of HEK-293 using 10702-1-AP (same clone as 10702-1-PBS)

  WB result of VAMP3/Cellubrevin antibody (10702-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-VAMP3/Cellubrevin transfected HEK-293 cells. This data was developed using the same antibody clone with 10702-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 10702-1-AP (same clone as 10702-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 10702-1-AP (VAMP3/Cellubrevin antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10702-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 10702-1-AP (same clone as 10702-1-PBS)

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 10702-1-AP (VAMP3/Cellubrevin antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10702-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 10702-1-AP (same clone as 10702-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 10702-1-AP (VAMP3/Cellubrevin antibody at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10702-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HEK-293 using 10702-1-AP (same clone as 10702-1-PBS)

  IP result of anti-VAMP3/Cellubrevin (IP:10702-1-AP, 4ug; Detection:10702-1-AP 1:1000) with HEK-293 cells lysate 3000ug. This data was developed using the same antibody clone with 10702-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 10702-1-AP (same clone as 10702-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 10702-1-AP (VAMP3/Cellubrevin antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10702-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 10702-1-AP (same clone as 10702-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 10702-1-AP (VAMP3/Cellubrevin antibody at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 10702-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 10702-1-AP (same clone as 10702-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 10702-1-AP (VAMP3/Cellubrevin antibody at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 10702-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

VAMP3/Cellubrevin Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 10702-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

VAMP3, CEB, Cellubrevin, SYB3, Synaptobrevin-3

---

Product Information

10702-1-PBS targets VAMP3/Cellubrevin in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1156

  Product name: Recombinant human VAMP3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-99 aa of BC005941

  Sequence: MSTGPTAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCEMWAIGITVLVIFIIIIIVWVVS

• Full Name: vesicle-associated membrane protein 3 (cellubrevin)
• Calculated Molecular Weight: 11 kDa
• Observed Molecular Weight: 11-17 kDa
• GenBank Accession Number: BC005941
• Gene Symbol: VAMP3
• Gene ID (NCBI): 9341
• RRID: AB_2212628
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15836
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

VAMP3, also named as cellubrevin or synaptobrevin 3, is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. VAMP3 is a v-SNARE (soluble NSF-attachment protein receptor). Characterized by a common sequence called the SNARE motif, SNARE proteins are involved in membrane fusion and vesicular transport (PMID: 11252968). VAMP3 resides in recycling endosomes and endosome-derived transport vesicles, involved in regulating membrane traffic. It is implicated in recycling of transferrin receptors, secretion of alpha-granules in platelets, and membrane trafficking during cell migration.