VAPA Monoclonal antibody

• 

  WB analysis using 67845-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67845-1-Ig (VAPA antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Beta Actin Monoclonal antibody (HRP-66009) as loading control.

• 

  IHC staining of human liver cancer using 67845-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67845-1-Ig (VAPA antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 67845-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67845-1-Ig (VAPA antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 67845-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67845-1-Ig (VAPA antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 67845-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67845-1-Ig (VAPA antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

VAPA Monoclonal Antibody for WB, IHC, ELISA

Cat No. 67845-1-Ig

Clone No.1F10F9

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse, Rat

Applications

WB, IHC, ELISA

Synonyms

33 kDa VAMP associated protein, hVAP 33, VAMP A, VAMP associated protein A, VAP 33, VAP A, VAP33, VAPA

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, PC-12 cells, NIH/3T3 cells, Neuro-2a cells
• Positive IHC detected in: human liver cancer tissue, human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67845-1-Ig targets VAPA in WB, IHC, ELISA applications and shows reactivity with Human, Mouse, Rat samples.

• Tested Reactivity: Human, Mouse, Rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7819

  Product name: Recombinant human VAPA protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-221 aa of BC002992

  Sequence: MASASGAMAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYCVRPNSGIIDPGSTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNTSDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSTASFR

• Full Name: VAMP (vesicle-associated membrane protein)-associated protein A, 33kDa
• Calculated Molecular Weight: 28 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: BC002992
• Gene Symbol: VAPA
• Gene ID (NCBI): 9218
• RRID: AB_2918607
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9P0L0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

VAPA (Vesicle-associated membrane protein-associated protein A), also known as VAP33, is a 33-kDa, ubiquitously expressed integral membrane protein of the VAMP-associated protein (VAP) family. It is present in the plasma membrane and in intracellular vesicles, playing a role in vesicle trafficking.