CoraLite® Plus 488-conjugated VAPA Monoclonal antibody

VAPA Monoclonal Antibody for FC (Intra)
Cat No. CL488-67845
Clone No.1F10F9

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

FC (Intra)

1F10F9, 33 kDa VAMP associated protein, 33 kDa VAMP-associated protein, hVAP 33, VAMP A

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67845 targets VAPA in FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag7819

Product name: Recombinant human VAPA protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-221 aa of BC002992

Sequence: MASASGAMAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYCVRPNSGIIDPGSTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNTSDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSTASFR

Predict reactive species
Full Name VAMP (vesicle-associated membrane protein)-associated protein A, 33kDa
Calculated Molecular Weight 28 kDa
Observed Molecular Weight 33 kDa
GenBank Accession NumberBC002992
Gene Symbol VAPA
Gene ID (NCBI) 9218
RRIDAB_2923801
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9P0L0
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

VAPA (Vesicle-associated membrane protein-associated protein A), also known as VAP33, is a 33-kDa, ubiquitously expressed integral membrane protein of the VAMP-associated protein (VAP) family. It is present in the plasma membrane and in intracellular vesicles, playing a role in vesicle trafficking.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 VAPA antibody CL488-67845Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...