Filter: AllWBIHC

WB analysis using 67753-1-Ig (same clone as 67753-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 67753-1-Ig (VASH2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Alpha Tubulin Monoclonal antibody (HRP-66031) as loading control. This data was developed using the same antibody clone with 67753-1-PBS in a different storage buffer formulation.
×
Various lysates were subjected to SDS PAGE followed by western blot with 67753-1-Ig (VASH2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Alpha Tubulin Monoclonal antibody (HRP-66031) as loading control. This data was developed using the same antibody clone with 67753-1-PBS in a different storage buffer formulation.
WB analysis using 67753-1-Ig (same clone as 67753-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 67753-1-Ig (VASH2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67753-1-PBS in a different storage buffer formulation.
IHC staining of human skin cancer using 67753-1-Ig (same clone as 67753-1-PBS)
Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 67753-1-Ig (VASH2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67753-1-PBS in a different storage buffer formulation.
IHC staining of human skin cancer using 67753-1-Ig (same clone as 67753-1-PBS)
Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 67753-1-Ig (VASH2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67753-1-PBS in a different storage buffer formulation.
IHC staining of human liver cancer using 67753-1-Ig (same clone as 67753-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67753-1-Ig (VASH2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67753-1-PBS in a different storage buffer formulation.
IHC staining of human liver cancer using 67753-1-Ig (same clone as 67753-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67753-1-Ig (VASH2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67753-1-PBS in a different storage buffer formulation.
IHC staining of human liver cancer using 67753-1-Ig (same clone as 67753-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67753-1-Ig (VASH2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67753-1-PBS in a different storage buffer formulation.
IHC staining of human liver cancer using 67753-1-Ig (same clone as 67753-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67753-1-Ig (VASH2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67753-1-PBS in a different storage buffer formulation.

VASH2 Monoclonal antibody, PBS Only

VASH2 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 67753-1-PBS

Clone No.3A11D10

Review Product

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

Vasohibin-like protein, Vasohibin-2, VASHL, Tubulinyl-Tyr carboxypeptidase 2, EC:3.4.17.17

Formulation: PBS Only

PBS and Azide

PBS Only

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

67753-1-PBS targets VASH2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Mouse / IgG1
Class	Monoclonal
Type	Antibody
Immunogen	CatNo: Ag29985 Product name: Recombinant human VASH2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-156 aa of BC028194 Sequence: METAKEMTRESLPIKCLEAVILGIYLTNGQPSIERFPISFKTYFSGNYFHHVVLGIYCNGRYGSLGMSRRAELMDKPLTFRTLSDLIFDFEDSYKKYLHTVKKVKIGLYVPHEPHSFQPIEWKQLVLNVSKMLRADIRKELEKYARDMRMKGLCSH Predict reactive species
Full Name	vasohibin 2
Calculated Molecular Weight	355 aa, 40 kDa
Observed Molecular Weight	30-34 kDa
GenBank Accession Number	BC028194
Gene Symbol	VASH2
Gene ID (NCBI)	79805
RRID	AB_2918521
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein G purification
UNIPROT ID	Q86V25
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

VASH2, also named as vasohibin 2, is an important pro-angiogenesis factor in solid tumor. It has been reported that VASH2 is expressed in mononuclear cells mobilized from bone marrow to promote angiogenesis. VASH2 also plays a key role in axon formation. VASH2 is localized as a nuclear type(with 311 amino acid residues) and cytoplasmic type (with 355 amino acid residues and low abundance). Cytoplasmic VASH2 is associated with carcinoma angiogenesis, while nuclear VASH2 may be associated with cell proliferation. 67753-1-Ig antibody recognizes both the nuclear and cytoplasmic isoforms. (PMID:23615928; 19204325; 31235911; 26177649)