VASH2 Monoclonal antibody

VASH2 Monoclonal Antibody for WB, IHC, ELISA
Cat No. 67753-1-Ig
Clone No.3A11D10

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Vasohibin-like protein, Vasohibin-2, VASHL, Tubulinyl-Tyr carboxypeptidase 2, EC:3.4.17.17

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inSKOV-3 cells, BGC-823 cells, L02 cells, HepG2 cells, HUVEC cells, HSC-T6 cells, NIH/3T3 cells, SGC-7901 cells, MKN-45 cells
Positive IHC detected inhuman skin cancer tissue, human liver cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67753-1-Ig targets VASH2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag29985

Product name: Recombinant human VASH2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-156 aa of BC028194

Sequence: METAKEMTRESLPIKCLEAVILGIYLTNGQPSIERFPISFKTYFSGNYFHHVVLGIYCNGRYGSLGMSRRAELMDKPLTFRTLSDLIFDFEDSYKKYLHTVKKVKIGLYVPHEPHSFQPIEWKQLVLNVSKMLRADIRKELEKYARDMRMKGLCSH

Predict reactive species
Full Name vasohibin 2
Calculated Molecular Weight 355 aa, 40 kDa
Observed Molecular Weight30-34 kDa
GenBank Accession NumberBC028194
Gene Symbol VASH2
Gene ID (NCBI) 79805
RRIDAB_2918521
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ86V25
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

VASH2, also named as vasohibin 2, is an important pro-angiogenesis factor in solid tumor. It has been reported that VASH2 is expressed in mononuclear cells mobilized from bone marrow to promote angiogenesis. VASH2 also plays a key role in axon formation. VASH2 is localized as a nuclear type(with 311 amino acid residues) and cytoplasmic type (with 355 amino acid residues and low abundance). Cytoplasmic VASH2 is associated with carcinoma angiogenesis, while nuclear VASH2 may be associated with cell proliferation. 67753-1-Ig antibody recognizes both the nuclear and cytoplasmic isoforms. (PMID:23615928; 19204325; 31235911; 26177649)

Protocols

Product Specific Protocols
IHC protocol for VASH2 antibody 67753-1-IgDownload protocol
WB protocol for VASH2 antibody 67753-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...