CoraLite®594-conjugated VAV1 Recombinant monoclonal antibody

• 

  IF Staining of Jurkat using CL594-86933-2

  Immunofluorescent analysis of (4% PFA) fixed Jurkat cells using CoraLite®594 VAV1 antibody (CL594-86933-2, Clone: 251870A5 ) at dilution of 1:200.

• 

  FC experiment of Jurkat using CL594-86933-2

  1x10^6 Jurkat cells were intracellularly stained with 0.4 ug Coralite®594 Vav1 Recombinant Antibody (CL594-86933-2, Clone:251870A5)(red), or 0.4 ug Isotype Control (blue). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019).

VAV1 Uni-rAb^® Recombinant Antibody for IF/ICC, FC (Intra)

Cat No. CL594-86933-2

Clone No.251870A5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra)

Synonyms

Proto oncogene vav, Proto-oncogene vav, VAV

---

Tested Applications

• Positive IF/ICC detected in: Jurkat cells
• Positive FC (Intra) detected in: Jurkat cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.4 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-86933-2 targets VAV1 in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag38665

  Product name: Recombinant human VAV1 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 442-790 aa of BC013361

  Sequence: EQFEMAISNIYPENATANGHDFQMFSFEETTSCKACQMLLRGTFYQGYRCHRCRASAHKECLGRVPPCGRHGQDFPGTMKKDKLHRRAQDKKRNELGLPKMEVFQEYYGLPPPPGAIGPFLRLNPGDIVELTKAEAEQNWWEGRNTSTNEIGWFPCNRVKPYVHGPPQDLSVHLWYAGPMERAGAESILANRSDGTFLVRQRVKDAAEFAISIKYNVEVKHIKIMTAEGLYRITEKKAFRGLTELVEFYQQNSLKDCFKSLDTTLQFPFKEPEKRTISRPAVGSTKYFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRVGWFPANYVEEDYSEYC

• Full Name: vav 1 guanine nucleotide exchange factor
• Calculated Molecular Weight: 845 aa, 98 kDa
• Observed Molecular Weight: 98 kDa
• GenBank Accession Number: BC013361
• Gene Symbol: VAV1
• Gene ID (NCBI): 7409
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Excitation Laser: Yellow-Green Laser (561 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P15498
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Vav proteins mainly act as enzymes that catalyze the activation step of Rho subfamily GTPases during cell signaling. There are three family members:VAV1, VAV2 and VAV3. Vav1 is specifically expressed in the hematopoietic system, whereas Vav2 and Vav3 are more ubiquitously expressed (PMID:14607270). Vav1 is physiologically active as a GDP/GTP nucleotide exchange factor (GEF) in the hematopoietic system (PMID:31654719).