VDAC2 Recombinant monoclonal antibody

VDAC2 Uni-rAb® Recombinant Antibody for IHC, IF/ICC, FC (Intra), ELISA
Cat No. 84225-3-RR
Clone No.241569C3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF/ICC, FC (Intra), ELISA

241569C3, FLJ23841, hVDAC2, VDAC 2, VDAC-2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inmouse heart tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

84225-3-RR targets VDAC2 in IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag2266

Product name: Recombinant human VDAC2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-294 aa of BC000165

Sequence: MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSSYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRNNFAVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNCTRFGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSINAGGHKVGLALELEA

Predict reactive species
Full Name voltage-dependent anion channel 2
Calculated Molecular Weight 294 aa, 32 kDa
GenBank Accession NumberBC000165
Gene Symbol VDAC2
Gene ID (NCBI) 7417
RRIDAB_3671779
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP45880
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

VDACs (Voltage Dependent Anion selective Channels), also known as mitochondrial porins, are a family of pore-forming proteins discovered in the mitochondrial outer membrane. Mammals show a conserved genetic organization of the VDAC genes. It's reported that the amount of VDAC transcripts in liver is usually lower than in the other tissues. VDAC2 and especially VDAC3 are highly expressed in testis, while mouse VDAC1 is poorly expressed in this tissue. (PMID: 22020053)

Protocols

Product Specific Protocols
FC protocol for VDAC2 antibody 84225-3-RRDownload protocol
IF protocol for VDAC2 antibody 84225-3-RRDownload protocol
IHC protocol for VDAC2 antibody 84225-3-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...