VDR Monoclonal antibody

• Home
• Products
• Primary Antibodies
• VDR Monoclonal antibody (67192-1-Ig)

• Featured Product
• KD/KO Validated

VDR Monoclonal Antibody for WB, ELISA

Cat No. 67192-1-Ig

Clone No.1A9C1

Publications(36)

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF, ChIP, ELISA

Synonyms

1A9C1, NR1I1, Vitamin D3 receptor

• 

  WB analysis using 67192-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67192-1-Ig (VDR antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 67192-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67192-1-Ig (VDR antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 67192-1-Ig

  HeLa cells were subjected to SDS PAGE followed by western blot with 67192-1-Ig (VDR antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 67192-1-Ig

  HeLa cells were subjected to SDS PAGE followed by western blot with 67192-1-Ig (VDR antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: MCF-7 cells, HeLa cells, HSC-T6 cells, T-47D cells, NCCIT cells, COLO 320 cells, 4T1 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67192-1-Ig targets VDR in WB, IHC, IF, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28188

  Product name: Recombinant human VDR protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 81-220 aa of BC060832

  Sequence: LKRCVDIGMMKEFILTDEEVQRKREMILKRKEEEALKDSLRPKLSEEQQRIIAILLDAHHKTYDPTYSDFCQFRPPVRVNDGGGSHPSRPNSRHTPSFSGDSSSSCSDHCITSSDMMDSSSFSNLDLSEEDSDDPSVTLE

• Full Name: vitamin D (1,25- dihydroxyvitamin D3) receptor
• Calculated Molecular Weight: 48 kDa
• Observed Molecular Weight: 48-55 kDa
• GenBank Accession Number: BC060832
• Gene Symbol: VDR
• Gene ID (NCBI): 7421
• RRID: AB_2882487
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P11473
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The vitamin D3 receptor (VDR), also known as NR1I1 (nuclear receptor subfamily 1, group I, member 1), is a member of the nuclear receptor family of transcription factors. Upon activation by vitamin D, the VDR forms a heterodimer with the retinoid-X receptor and binds to hormone response elements on DNA resulting in expression or trans-repression of specific gene products.It is an intracellular hormone receptor that specifically binds 1,25(OH)2D3 and mediates its effects. Downstream targets of this nuclear hormone receptor are principally involved in mineral metabolism though the receptor regulates a variety of other metabolic pathways, such as those involved in the immune response and cancer. Defects in VDR are the cause of rickets vitamin D-dependent type 2A (VDDR2A). A disorder of vitamin D metabolism results in severe rickets, hypocalcemia and secondary hyperparathyroidism. Most patients have total alopecia in addition to rickets. The VDR exists two isoform with the MV 48 kDa and 54 kDa.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		J Nanobiotechnology; Nanoengineered bile acid-mediated orchestration of versatile immuno-microbial cues for treating periodontitis.; Authors - Shuang Li
mouse	IF	Cell Commun Signal; Vitamin D receptor (VDR) on the cell membrane of mouse macrophages participates in the formation of lipopolysaccharide tolerance: mVDR is related to the effect of artesunate to reverse LPS tolerance; Authors - Yu Zhang
mouse	WB	Phytomedicine; Asperuloside inhibited epithelial-mesenchymal transition in colitis associated cancer via activation of vitamin D receptor.; Authors - Yingyu Lu ; KD Validated
mouse	WB	Mater Today Bio; Alendronic acid modified PLGA drug delivery system loaded with 17β-Estradiol and vitamin D3 has anti-osteoporotic effect.; Authors - Yonghui Wang
human	WB	Cell Death Discov; Claudin1 decrease induced by 1,25-dihydroxy-vitamin D3 potentiates gefitinib resistance therapy through inhibiting AKT activation-mediated cancer stem-like properties in NSCLC cells.; Authors - Zhirong Jia
mouse	WB	J Transl Med; Notch3 enhances the synergistic effect of all-trans retinoic acid and calcipotriol in pancreatic stellate cell activation; Authors - Zheng Lian