Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

VDR Monoclonal antibody

VDR Monoclonal Antibody for WB, ELISA

Cat No. 67192-1-Ig
Clone No. 1A9C1
Publications (36)
Review Product
Download datasheet

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF, ChIP, ELISA

1A9C1, NR1I1, Vitamin D3 receptor

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for VDR in ?

Tested Applications

Positive WB detected inMCF-7 cells, HeLa cells, HSC-T6 cells, T-47D cells, NCCIT cells, COLO 320 cells, 4T1 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67192-1-Ig targets VDR in WB, IHC, IF, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28188

Product name: Recombinant human VDR protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 81-220 aa of BC060832

Sequence: LKRCVDIGMMKEFILTDEEVQRKREMILKRKEEEALKDSLRPKLSEEQQRIIAILLDAHHKTYDPTYSDFCQFRPPVRVNDGGGSHPSRPNSRHTPSFSGDSSSSCSDHCITSSDMMDSSSFSNLDLSEEDSDDPSVTLE

Predict reactive species
Full Name vitamin D (1,25- dihydroxyvitamin D3) receptor
Calculated Molecular Weight 48 kDa
Observed Molecular Weight 48-55 kDa
GenBank Accession NumberBC060832
Gene Symbol VDR
Gene ID (NCBI) 7421
RRIDAB_2882487
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP11473
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The vitamin D3 receptor (VDR), also known as NR1I1 (nuclear receptor subfamily 1, group I, member 1), is a member of the nuclear receptor family of transcription factors. Upon activation by vitamin D, the VDR forms a heterodimer with the retinoid-X receptor and binds to hormone response elements on DNA resulting in expression or trans-repression of specific gene products.It is an intracellular hormone receptor that specifically binds 1,25(OH)2D3 and mediates its effects. Downstream targets of this nuclear hormone receptor are principally involved in mineral metabolism though the receptor regulates a variety of other metabolic pathways, such as those involved in the immune response and cancer. Defects in VDR are the cause of rickets vitamin D-dependent type 2A (VDDR2A). A disorder of vitamin D metabolism results in severe rickets, hypocalcemia and secondary hyperparathyroidism. Most patients have total alopecia in addition to rickets. The VDR exists two isoform with the MV 48 kDa and 54 kDa.

Protocols

Product Specific Protocols
WB protocol for VDR antibody 67192-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The antibody is a Vitamin D Receptor (VDR) antibody, catalog number 67192-1-Ig, with a total of 36 citations. Citations appear in journals including Cell Death & Discovery, J Nanobiotechnology, Phytomedicine, Mater Today Bio, J Transl Med, CNS Neuroscience & Therapeutics, Cells, Frontiers series, European Journal of Pharmacology, International Immunopharmacology, Science Reports, Cell Signaling, and others. Research fields span vitamin D signaling, fibrosis, oncology, neurology, immunology, metabolic disease, bone biology, and sepsis.

SpeciesApplicationTitle

J Nanobiotechnology

Nanoengineered bile acid-mediated orchestration of versatile immuno-microbial cues for treating periodontitis.

Authors - Shuang Li
mouseIF

Cell Commun Signal

Vitamin D receptor (VDR) on the cell membrane of mouse macrophages participates in the formation of lipopolysaccharide tolerance: mVDR is related to the effect of artesunate to reverse LPS tolerance

Authors - Yu Zhang
mouseWB

Phytomedicine

Asperuloside inhibited epithelial-mesenchymal transition in colitis associated cancer via activation of vitamin D receptor.

Authors - Yingyu Lu
  • KD Validated
mouseWB

Mater Today Bio

Alendronic acid modified PLGA drug delivery system loaded with 17β-Estradiol and vitamin D3 has anti-osteoporotic effect.

Authors - Yonghui Wang
humanWB

Cell Death Discov

Claudin1 decrease induced by 1,25-dihydroxy-vitamin D3 potentiates gefitinib resistance therapy through inhibiting AKT activation-mediated cancer stem-like properties in NSCLC cells.

Authors - Zhirong Jia
mouseWB

J Transl Med

Notch3 enhances the synergistic effect of all-trans retinoic acid and calcipotriol in pancreatic stellate cell activation

Authors - Zheng Lian
Loading...
||
New chat

Able™

正在加载,请稍候...