• Featured Product
  • KD/KO Validated

VDR Monoclonal antibody, PBS Only

VDR Monoclonal Antibody for WB, Indirect ELISA
Cat No. 67192-1-PBS
Clone No.1A9C1

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

1A9C1, NR1I1, Vitamin D3 receptor

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67192-1-PBS targets VDR in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28188

Product name: Recombinant human VDR protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 81-220 aa of BC060832

Sequence: LKRCVDIGMMKEFILTDEEVQRKREMILKRKEEEALKDSLRPKLSEEQQRIIAILLDAHHKTYDPTYSDFCQFRPPVRVNDGGGSHPSRPNSRHTPSFSGDSSSSCSDHCITSSDMMDSSSFSNLDLSEEDSDDPSVTLE

Predict reactive species
Full Name vitamin D (1,25- dihydroxyvitamin D3) receptor
Calculated Molecular Weight 48 kDa
Observed Molecular Weight 48-55 kDa
GenBank Accession NumberBC060832
Gene Symbol VDR
Gene ID (NCBI) 7421
RRIDAB_2882487
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP11473
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

The vitamin D3 receptor (VDR), also known as NR1I1 (nuclear receptor subfamily 1, group I, member 1), is a member of the nuclear receptor family of transcription factors. Upon activation by vitamin D, the VDR forms a heterodimer with the retinoid-X receptor and binds to hormone response elements on DNA resulting in expression or trans-repression of specific gene products.It is an intracellular hormone receptor that specifically binds 1,25(OH)2D3 and mediates its effects. Downstream targets of this nuclear hormone receptor are principally involved in mineral metabolism though the receptor regulates a variety of other metabolic pathways, such as those involved in the immune response and cancer. Defects in VDR are the cause of rickets vitamin D-dependent type 2A (VDDR2A). A disorder of vitamin D metabolism results in severe rickets, hypocalcemia and secondary hyperparathyroidism. Most patients have total alopecia in addition to rickets. The VDR exists two isoform with the MV 48 kDa and 54 kDa.

Loading...
||
New chat Able
正在加载,请稍候...