CoraLite® Plus 488-conjugated VEGFR2/KDR Monoclonal antibody

VEGFR2/KDR Monoclonal Antibody for
Cat No. CL488-67407
Clone No.1G2A8

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

CD309, Fetal liver kinase 1, FLK 1, FLK1, KDR, Kinase insert domain receptor, VEGFR, VEGFR 2, VEGFR2

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

CL488-67407 targets VEGFR2/KDR in applications and shows reactivity with Human samples.

Tested Reactivity Human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag24589

Product name: Recombinant human KDR protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1158-1345 aa of BC131822

Sequence: EHLGNLLQANAQQDGKDYIVLPISETLSMEEDSGLSLPTSPVSCMEEEEVCDPKFHYDNTAGISQYLQNSKRKSRPVSVKTFEDIPLEEPEVKVIPDDNQTDSGMVLASEELKTLEDRTKLSPSFGGMVPSKSRESVASEGSNQTSGYQSGYHSDDTDTTVYSSEEAELLKLIEIGVQTGSTAQILQP

Predict reactive species
Full Name kinase insert domain receptor (a type III receptor tyrosine kinase)
Calculated Molecular Weight 1356 aa, 152 kDa
Observed Molecular Weight 230 kDa
GenBank Accession NumberBC131822
Gene Symbol KDR
Gene ID (NCBI) 3791
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP35968
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

KDR, also named as VEGFR-2, FLK1 and CD309, is a receptor for VEGF or VEGFC. KDR which belongs to the protein kinase superfamily, has a tyrosine-protein kinase activity. The VEGF-kinase ligand/receptor signaling system plays a key role in vascular development and regulation of vascular permeability. In case of HIV-1 infection, the interaction with extracellular viral Tat protein seems to enhance angiogenesis in Kaposi's sarcoma lesions. KDR functions as the main mediator of VEGF-induced endothelial proliferation, survival, migration, tubular morphogenesis and sprouting. Mutations of this gene are implicated in infantile capillary hemangiomas.

Loading...
||
New chat Able
正在加载,请稍候...