VEZT Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• VEZT Polyclonal antibody, PBS Only (17684-1-PBS)

• 

  WB analysis using 17684-1-AP (same clone as 17684-1-PBS)

  mouse eye tissue were subjected to SDS PAGE followed by western blot with 17684-1-AP (VEZT antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17684-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 17684-1-AP (same clone as 17684-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 17684-1-AP (VEZT antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17684-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 17684-1-AP (same clone as 17684-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 17684-1-AP (VEZT antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17684-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse brain using 17684-1-AP (same clone as 17684-1-PBS)

  IP result of anti-VEZT (IP:17684-1-AP, 4ug; Detection:17684-1-AP 1:500) with mouse brain tissue lysate 4400ug. This data was developed using the same antibody clone with 17684-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 17684-1-AP (same clone as 17684-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 17684-1-AP (VEZT antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17684-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 17684-1-AP (same clone as 17684-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 17684-1-AP (VEZT antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17684-1-PBS in a different storage buffer formulation.

VEZT Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 17684-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

---

Product Information

17684-1-PBS targets VEZT in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11786

  Product name: Recombinant human VEZT protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 382-731 aa of BC064939

  Sequence: VRSLQLHLKALLNEVIILEDELEKLVCTKETQELVSEAYPILEQKLKLIQPHVQASNNCWEEAISQVDKLLRRNTDKKGKPEIACENPHCTVVPLKQPTLHIADKDPIPEEQELEAYVDDIDIDSDFRKDDFYYLSQEDKERQKREHEESKRVLQELKSVLGFKASEAERQKWKQLLFSDHAVLKSLSPVDPVEPISNSEPSMNSDMGKVSKNDTEEESNKSATTDNEISRTEYLCENALEGKNKDNSSNEVFPQGAEERMCYQCESEDEPQADGSGLTTAPPTPRDSLQPSIKQRLARLQLSPDFTFTAGLAAEVAARSLSFTTMQEQTFGDEEEEQIIEENKNEIEEK

• Full Name: vezatin, adherens junctions transmembrane protein
• Calculated Molecular Weight: 731 aa, 83 kDa
• Observed Molecular Weight: 89 kDa, 125 kDa
• GenBank Accession Number: BC064939
• Gene Symbol: VEZT
• Gene ID (NCBI): 55591
• RRID: AB_2213139
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HBM0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Vezatin (VEZT) is an adherens junctions transmembrane protein which identified as a putative tumor suppressor. In case of Listeria infection, it promotes bacterial internalization by participating in myosin VIIa recruitment to the entry site. There're two isoforms with calculated MW 89 kDa and 65 kDa. With modification or glycosylation, the MW in Western blot detection will be presented as ~125 kDa and ~89 kDa (PMID: 11080149) or 65-71 kDa and 88-100 kDa (PMID: 20049712). There're some isoforms with MW less than 70 kDa.