Anti-Human VHL Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• Anti-Human VHL Rabbit Recombinant Antibody (98753-3-RR)

VHL Uni-rAb^® Recombinant Antibody for FC (Intra)

Cat No. 98753-3-RR

Clone No.251968A5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC (Intra)

Synonyms

Protein G7, pVHL, RCA1, VHL 1, VHL1

• 

  FC experiment of Transfected CHO using 98753-3-RR

  1x10^6 CHO cells or VHL transfected CHO cells were intracellularly stained with 0.25 ug Anti-Human VHL Rabbit RecAb (98753-3-RR, Clone: 251968A5) or 0.25 ug Isotype Control, and APC-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00017).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of Transfected CHO using 98753-3-RR

  x10^6 CHO cells or VHL transfected CHO cells were intracellularly stained with 0.25 ug Anti-Human VHL Rabbit RecAb (98753-3-RR, Clone:251968A5) (red) or 0.25 ug Isotype Control (blue), and APC-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00017).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of HepG2 using 98753-3-RR

  1x10^6 HepG2 cells were intracellularly stained with 0.25 ug Anti-Human VHL Rabbit RecAb (98753-3-RR, Clone: 251968A5) (red) or 0.25 ug Isotype Control (blue), and APC-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00017).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive FC (Intra) detected in: Transfected CHO cells, HepG2 cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

98753-3-RR targets VHL in FC (Intra) applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg6405

  Product name: Recombinant human VHL protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 1-213 aa of NM_000551.4

  Sequence: MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD

• Full Name: von Hippel-Lindau tumor suppressor
• Calculated Molecular Weight: 24 kDa
• GenBank Accession Number: NM_000551.4
• Gene Symbol: VHL
• Gene ID (NCBI): 7428
• RRID: AB_3746321
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P40337
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Background Information

VHL (von Hippel-Lindau tumor suppressor) gene was identified as the tumor suppressor gene whose germ line mutations are associated with the inherited von Hippel-Lindau cancer syndrome (PMID: 8603073, 10722748). VHL patients develop a wide variety of tumors including retinal angioma, central nervous system hemangioblastoma, pheochromocytoma, and renal clear cell carcinoma (PMID: 10722748). VHL localizes predominantly to the cytoplasmic compartment but engages in a dynamic nuclear-cytoplasmic shuttle (PMID: 8700833, 9891082, 12101228).