VLGR1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• VLGR1 Polyclonal antibody, PBS Only (31628-1-PBS)

• 

  WB analysis using 31628-1-AP (same clone as 31628-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31628-1-AP (VLGR1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31628-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 31628-1-AP (same clone as 31628-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31628-1-AP (VLGR1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31628-1-PBS in a different storage buffer formulation.

• 

  IP experiment of SH-SY5Y using 31628-1-AP (same clone as 31628-1-PBS)

  IP result of anti-VLGR1 (IP:31628-1-AP, 4ug; Detection:31628-1-AP 1:500) with SH-SY5Y cells lysate 1920 ug. This data was developed using the same antibody clone with 31628-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung using 31628-1-AP (same clone as 31628-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 31628-1-AP (VLGR1 antibody) at dilution of 1:100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31628-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung using 31628-1-AP (same clone as 31628-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 31628-1-AP (VLGR1 antibody) at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31628-1-PBS in a different storage buffer formulation.

VLGR1 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 31628-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

ADGRV1, GPR98, ADGRV1 subunit alpha, ADGRV1 subunit beta, Adhesion G-protein coupled receptor V1

---

Product Information

31628-1-PBS targets VLGR1 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34635

  Product name: Recombinant human ADGRV1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2269-2812 aa of NM_032119

  Sequence: ESIIVSLVYTEGGSRILPSSDTVRVNILANDNVAGIVSFQTASRSVIGHEGEILQFHVIRTFPGRGNVTVNWKIIGQNLELNFANFSGQLFFPEGSLNTTLFVHLLDDNIPEEKEVYQVILYDVRTQGVPPAGIALLDAQGYAA

• Full Name: G protein-coupled receptor 98
• Calculated Molecular Weight: 693 kDa
• Observed Molecular Weight: 217 kDa
• GenBank Accession Number: NM_032119
• Gene Symbol: GPR98
• Gene ID (NCBI): 84059
• RRID: AB_3742457
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8WXG9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

VLGR1 (very large G protein-coupled receptor-1), also known as ADGRV1, GPR98, and MASS, has a molecular weight of up to 700 kDa, making it the largest member of the 33 adhesive G protein-coupled receptors (ADGRs), a unique subfamily of the GPCR superfamily. The full-length VLGR1 encompasses ∼6300 amino acids and thus is difficult to analyze by electrophoresis. Vlgr1 is a core component of ankle-link complex in inner ear hair cells. Knock-out and mutation mouse models show that loss of Vlgr1 function leads to abnormal stereociliary development and hearing loss, indicating crucial roles of Vlgr1 in hearing transduction or auditory system development (PMID: 23180093). Western blot analysis detected VLGR1a isoform at an apparent molecular mass of 217 kDa .