VNN1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• VNN1 Polyclonal antibody, PBS Only (21745-1-PBS)

• 

  WB analysis of BxPC-3 using 21745-1-AP (same clone as 21745-1-PBS)

  BxPC-3 cells were subjected to SDS PAGE followed by western blot with 21745-1-AP (VNN1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21745-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 21745-1-AP (same clone as 21745-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21745-1-AP (VNN1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21745-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse kidney using 21745-1-AP (same clone as 21745-1-PBS)

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 21745-1-AP (VNN1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21745-1-PBS in a different storage buffer formulation.

• 

  WB analysis of PC-13 using 21745-1-AP (same clone as 21745-1-PBS)

  PC-13 cells were subjected to SDS PAGE followed by western blot with 21745-1-AP (VNN1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21745-1-PBS in a different storage buffer formulation.

• 

  WB analysis of PC-13 using 21745-1-AP (same clone as 21745-1-PBS)

  PC-13 cells were subjected to SDS PAGE followed by western blot with 21745-1-AP (VNN1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21745-1-PBS in a different storage buffer formulation.

• 

  WB analysis of BxPC-3 using 21745-1-AP (same clone as 21745-1-PBS)

  BxPC-3 cells were subjected to SDS PAGE followed by western blot with 21745-1-AP (VNN1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21745-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

VNN1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 21745-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

21745-1-PBS targets VNN1 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16501

  Product name: Recombinant human VNN1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 302-513 aa of BC096268

  Sequence: SQLDSHPSHSAVVNWTSYASSIEALSSGNKEFKGTVFFDEFTFVKLTGVAGNYTVCQKDLCCHLSYKMSENIPNEVYALGAFDGLHTVEGRYYLQICTLLKCKTTNLNTCGDSAETASTRFEMFSLSGTFGTQYVFPEVLLSENQLAPGEFQVSTDGRLFSLKPTSGPVLTVTLFGRLYEKDWASNASSGLTAQARIIMLIVIAPIVCSLSW

• Full Name: vanin 1
• Calculated Molecular Weight: 513 aa, 57 kDa
• Observed Molecular Weight: 55-72 kDa
• GenBank Accession Number: BC096268
• Gene Symbol: VNN1
• Gene ID (NCBI): 8876
• RRID: AB_10734328
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95497
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

VNN1(Vascular non-inflammatory molecule 1) is also named as Vanin-1, Pantetheinase, Tiff66. It is a GPI-anchored 70-kDa protein with a high degree of homology with GPI-80 (also known as VNN2), a molecule expressed by human phagocytes and involved in leukocyte adhesion and migration. Vanin-1 is predominantly expressed by resident tissue cells and acts at the level of epithelial cells and surrounding hematopoietic cells by paracrine 2-Mercaptoethylamine release(PMID:17163446). The full length VNN1 has a signal peptide, a propeptide and six glycosylation sites. According to some authors, the variations which varied between 55 and 72kDa may be due to different degrees of glycosylation of the protein and cleavage (JOSE A et al. 2001).