VPS36 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• VPS36 Polyclonal antibody, PBS Only (14262-1-PBS)

• 

  WB analysis of HL-60 using 14262-1-AP (same clone as 14262-1-PBS)

  HL-60 cells were subjected to SDS PAGE followed by western blot with 14262-1-AP (VPS36 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14262-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 14262-1-AP (same clone as 14262-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 14262-1-AP (VPS36 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14262-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 14262-1-AP (same clone as 14262-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 14262-1-AP (VPS36 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14262-1-PBS in a different storage buffer formulation.

VPS36 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 14262-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

ELL-associated protein of 45 kDa, EAP45, CGI-145, CGI145, CGI 145

---

Product Information

14262-1-PBS targets VPS36 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5549

  Product name: Recombinant human VPS36 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 1-386 aa of BC050439

  Sequence: MDRFVWTSGLLEINETLVIQQRGVRIYDGEEKIKFDAGTLLLSTHRLIWRDQKNHECCMAILLSQIVFIEEQAAGIGKSAKIVVHLHPAPPNKEPGPFQSSKNSYIKLSFKEHGQIEFYRRLSEEMTQRRWENMPVSQSLQTNRGPQPGRIRAVGIVGIERKLEEKRKETDKNISEAFEDLSKLMIKAKEMVELSKSIANKIKDKQGDITEDETIRFKSYLLSMGIANPVTRETYGSGTQYHMQLAKQLAGILQVPLEERGGIMSLTEVYCLVNRARGMELLSPEDLVNACKMLEALKLPLRLRVFDSGVMVIELQSHKEEEMVASALETVSEKGSLTSEEFAKLVGMSVLLAKERLLLAEKMGHLCRDDSVEGLRFYPNLFMTQS

• Full Name: vacuolar protein sorting 36 homolog (S. cerevisiae)
• Calculated Molecular Weight: 44 kDa
• Observed Molecular Weight: 43 kDa, 65 kDa
• GenBank Accession Number: BC050439
• Gene Symbol: VPS36
• Gene ID (NCBI): 51028
• RRID: AB_2878036
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86VN1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.