VPS37B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• VPS37B Polyclonal antibody, PBS Only (15653-1-PBS)

• 

  WB analysis of HeLa using 15653-1-AP (same clone as 15653-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 15653-1-AP (VPS37B Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15653-1-PBS in a different storage buffer formulation.

• 

  WB analysis of COLO 320 using 15653-1-AP (same clone as 15653-1-PBS)

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 15653-1-AP (VPS37B Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15653-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

VPS37B Polyclonal Antibody for WB, Indirect ELISA

Cat No. 15653-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

ESCRT I complex subunit VPS37B, ESCRT-I complex subunit VPS37B, hVps37B, Vacuolar protein sorting-associated protein 37B

---

Product Information

15653-1-PBS targets VPS37B in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8256

  Product name: Recombinant human VPS37B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-285 aa of BC005882

  Sequence: MAGAGSEARFAGLSLVQLNELLEDEGQLTEMVQKMEETQNVQLNKEMTLASNRSLAEGNLLYQPQLDTLKARLTQKYQELQVLFEAYQIKKTKLDRQSSSASLETLLALLQAEGAKIEEDTENMAEKFLDGELPLDSFIDVYQSKRKLAHMRRVKIEKLQEMVLKGQRLPQALAPLPPRLPELAPTAPLPYPAPEASGPPAVAPRRIPPPPPPVPAGRLATPFTAAMSSGQAVPYPGLQCPPLPPRVGLPTQQGFSSQFVSPYPPPLPQRPPPRLPPHQPGFILQ

• Full Name: vacuolar protein sorting 37 homolog B (S. cerevisiae)
• Calculated Molecular Weight: 31 kDa
• Observed Molecular Weight: 31 kDa
• GenBank Accession Number: BC005882
• Gene Symbol: VPS37B
• Gene ID (NCBI): 79720
• RRID: AB_2878161
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H9H4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

VPS37B (Vacuolar Protein Sorting 37 Homolog B) is a conserved eukaryotic protein that serves as a critical subunit of the Endosomal Sorting Complex Required for Transport (ESCRT)-I complex. The ESCRT system is a sophisticated molecular machinery essential for mediating fundamental membrane remodeling events in cells. VPS37B plays a specific and vital role in this system, contributing to diverse cellular processes.