VPS4A Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• VPS4A Polyclonal antibody, PBS Only (14272-1-PBS)

• 

  WB analysis using 14272-1-AP (same clone as 14272-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 14272-1-AP (VPS4A antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14272-1-PBS in a different storage buffer formulation.

• 

  WB analysis of U-937 using 14272-1-AP (same clone as 14272-1-PBS)

  WB result of VPS4A antibody (14272-1-AP; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-VPS4A transfected U-937 cells. This data was developed using the same antibody clone with 14272-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 14272-1-AP (same clone as 14272-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 14272-1-AP (VPS4A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14272-1-PBS in a different storage buffer formulation.

• 

  WB analysis of SMMC-7721 using 14272-1-AP (same clone as 14272-1-PBS)

  SMMC-7721 cells were subjected to SDS PAGE followed by western blot with 14272-1-AP (VPS4A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14272-1-PBS in a different storage buffer formulation.

• 

  WB analysis of SMMC-7721 using 14272-1-AP (same clone as 14272-1-PBS)

  SMMC-7721 cells were subjected to SDS PAGE followed by western blot with 14272-1-AP (VPS4A antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14272-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 14272-1-AP (same clone as 14272-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 14272-1-AP (VPS4A antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14272-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 14272-1-AP (same clone as 14272-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 14272-1-AP (VPS4A antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14272-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 14272-1-AP (same clone as 14272-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 14272-1-AP (VPS4A antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14272-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

VPS4A Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 14272-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

EC:3.6.4.6, hVPS4, Protein SKD2, SKD1, SKD2

---

Product Information

14272-1-PBS targets VPS4A in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5592

  Product name: Recombinant human VPS4A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 86-437 aa of BC047932

  Sequence: KENQSEGKGSDSDSEGDNPEKKKLQEQLMGAVVMEKPNIRWNDVAGLEGAKEALKEAVILPIKFPHLFTGKRTPWRGILLFGPPGTGKSYLAKAVATEANNSTFFSVSSSDLMSKWLGESEKLVKNLFELARQHKPSIIFIDEVDSLCGSRNENESEAARRIKTEFLVQMQGVGNNNDGTLVLGATNIPWVLDSAIRRRFEKRIYIPLPEEAARAQMFRLHLGSTPHNLTDANIHELARKTEGYSGADISIIVRDSLMQPVRKVQSATHFKKVCGPSRTNPSMMIDDLLTPCSPGDPGAMEMTWMDVPGDKLLEPVVCMSDMLRSLATTRPTVNADDLLKVKKFSEDFGQES

• Full Name: vacuolar protein sorting 4 homolog A (S. cerevisiae)
• Calculated Molecular Weight: 49 kDa
• Observed Molecular Weight: 48-55 kDa
• GenBank Accession Number: BC047932
• Gene Symbol: VPS4A
• Gene ID (NCBI): 27183
• RRID: AB_2878039
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UN37
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Vacuolar Protein Sorting 4A (VPS4A) is one of two human homologs of the yeast protein Vps4 and member of the AAA protein family (ATPases associated with diverse cellular activities).