VPS54 Monoclonal antibody

• 

  WB analysis of SH-SY5Y using 67404-1-Ig

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 67404-1-Ig (VPS54 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of pig brain using 67404-1-Ig

  pig brain tissue were subjected to SDS PAGE followed by western blot with 67404-1-Ig (VPS54 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver cancer using 67404-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67404-1-Ig (VPS54 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 67404-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67404-1-Ig (VPS54 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

VPS54 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 67404-1-Ig

Clone No.3D12D1

Host / Isotype

Mouse / IgG1

Reactivity

Human, Pig, Mouse, Rat

Applications

WB, IHC, ELISA

Synonyms

HCC8, hVps54L, SLP 8p, Tumor antigen HOM HCC 8, Tumor antigen SLP 8p, VPS54, VPS54L

---

Tested Applications

• Positive WB detected in: SH-SY5Y cells, pig brain tissue
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67404-1-Ig targets VPS54 in WB, IHC, ELISA applications and shows reactivity with Human, Pig, Mouse, Rat samples.

• Tested Reactivity: Human, Pig, Mouse, Rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4123

  Product name: Recombinant human VPS54 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 746-965 aa of BC030275

  Sequence: CVDNIPSVTTDMLTRLSDLLKYFNSRSCQLVLGAGALQVVGLKTITTKNLALSSRCLQLIVHYIPVIRAHFEARLPPKQYSMLRHFDHITKDYHDHIAEISAKLVAIMDSLFDKLLSKYEVKAPVPSACFRNICKQMTKMHEAIFDLLPEEQTQMLFLRINASYKLHLKKQLSHLNVINDGGPQNGLVTADVAFYTGNLQALKGLKDLDLNMAEIWEQKR

• Full Name: vacuolar protein sorting 54 homolog (S. cerevisiae)
• Calculated Molecular Weight: 977 aa, 111 kDa
• Observed Molecular Weight: 100-110 kDa
• GenBank Accession Number: BC030275
• Gene Symbol: VPS54
• Gene ID (NCBI): 51542
• RRID: AB_2882645
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9P1Q0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

VPS54 is a part of the Golgi-associated retrograde protein (GARP) complex protein required for tethering and fusion of endosome-derived transport vesicles to the trans-Golgi network. It may particpate in retrograde transport from early and late endosomes to the late Golgi. The GARP complex is required for the maintenance of the cycling of mannose 6-phosphate receptors between the TGN and endosomes, this cycling is necessary for proper lysosomal sorting of acid hydrolases such as CTSD.