VPS54 Monoclonal antibody, PBS Only (Detector)

VPS54 Monoclonal Antibody for WB, IHC, Cytometric bead array, Indirect ELISA
Cat No. 67404-1-PBS
Clone No.3D12D1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, Cytometric bead array, Indirect ELISA

Vacuolar protein sorting-associated protein 54, Tumor antigen SLP-8p, Tumor antigen HOM-HCC-8, Hepatocellular carcinoma protein 8, HCC8

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67404-1-PBS targets VPS54 as part of a matched antibody pair:

MP51221-2: 67404-2-PBS capture and 67404-1-PBS detection (validated in Cytometric bead array)

MP51221-3: 67404-3-PBS capture and 67404-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag4123

Product name: Recombinant human VPS54 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 746-965 aa of BC030275

Sequence: CVDNIPSVTTDMLTRLSDLLKYFNSRSCQLVLGAGALQVVGLKTITTKNLALSSRCLQLIVHYIPVIRAHFEARLPPKQYSMLRHFDHITKDYHDHIAEISAKLVAIMDSLFDKLLSKYEVKAPVPSACFRNICKQMTKMHEAIFDLLPEEQTQMLFLRINASYKLHLKKQLSHLNVINDGGPQNGLVTADVAFYTGNLQALKGLKDLDLNMAEIWEQKR

Predict reactive species
Full Name vacuolar protein sorting 54 homolog (S. cerevisiae)
Calculated Molecular Weight 977 aa, 111 kDa
Observed Molecular Weight 100-110 kDa
GenBank Accession NumberBC030275
Gene Symbol VPS54
Gene ID (NCBI) 51542
RRIDAB_2882645
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9P1Q0
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

VPS54 is a part of the Golgi-associated retrograde protein (GARP) complex protein required for tethering and fusion of endosome-derived transport vesicles to the trans-Golgi network. It may particpate in retrograde transport from early and late endosomes to the late Golgi. The GARP complex is required for the maintenance of the cycling of mannose 6-phosphate receptors between the TGN and endosomes, this cycling is necessary for proper lysosomal sorting of acid hydrolases such as CTSD.

Loading...
||
New chat

Able

正在加载,请稍候...