VPS54 Monoclonal antibody, PBS Only (Detector)

• 

  WB analysis of SH-SY5Y using 67404-1-Ig (same clone as 67404-1-PBS)

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 67404-1-Ig (VPS54 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67404-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig brain using 67404-1-Ig (same clone as 67404-1-PBS)

  pig brain tissue were subjected to SDS PAGE followed by western blot with 67404-1-Ig (VPS54 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67404-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67404-1-Ig (same clone as 67404-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67404-1-Ig (VPS54 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67404-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67404-1-Ig (same clone as 67404-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67404-1-Ig (VPS54 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67404-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array standard curve of MP51221-2

  Cytometric bead array standard curve of MP51221-2, VPS54 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67404-2-PBS. Detection antibody: 67404-1-PBS. Standard:Ag4123. Range: 0.195-25 ng/mL.

• 

  Cytometric bead array standard curve of MP51221-3

  Cytometric bead array standard curve of MP51221-3, VPS54 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67404-3-PBS. Detection antibody: 67404-1-PBS. Standard:Ag4123. Range: 0.195-12.5 ng/mL.

VPS54 Monoclonal Antibody for WB, IHC, Cytometric bead array, Indirect ELISA

Cat No. 67404-1-PBS

Clone No.3D12D1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, Cytometric bead array, Indirect ELISA

Synonyms

Vacuolar protein sorting-associated protein 54, Tumor antigen SLP-8p, Tumor antigen HOM-HCC-8, Hepatocellular carcinoma protein 8, HCC8

---

Product Information

67404-1-PBS targets VPS54 as part of a matched antibody pair:

MP51221-2: 67404-2-PBS capture and 67404-1-PBS detection (validated in Cytometric bead array)

MP51221-3: 67404-3-PBS capture and 67404-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4123

  Product name: Recombinant human VPS54 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 746-965 aa of BC030275

  Sequence: CVDNIPSVTTDMLTRLSDLLKYFNSRSCQLVLGAGALQVVGLKTITTKNLALSSRCLQLIVHYIPVIRAHFEARLPPKQYSMLRHFDHITKDYHDHIAEISAKLVAIMDSLFDKLLSKYEVKAPVPSACFRNICKQMTKMHEAIFDLLPEEQTQMLFLRINASYKLHLKKQLSHLNVINDGGPQNGLVTADVAFYTGNLQALKGLKDLDLNMAEIWEQKR

• Full Name: vacuolar protein sorting 54 homolog (S. cerevisiae)
• Calculated Molecular Weight: 977 aa, 111 kDa
• Observed Molecular Weight: 100-110 kDa
• GenBank Accession Number: BC030275
• Gene Symbol: VPS54
• Gene ID (NCBI): 51542
• RRID: AB_2882645
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9P1Q0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

VPS54 is a part of the Golgi-associated retrograde protein (GARP) complex protein required for tethering and fusion of endosome-derived transport vesicles to the trans-Golgi network. It may particpate in retrograde transport from early and late endosomes to the late Golgi. The GARP complex is required for the maintenance of the cycling of mannose 6-phosphate receptors between the TGN and endosomes, this cycling is necessary for proper lysosomal sorting of acid hydrolases such as CTSD.