VPS9D1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• VPS9D1 Polyclonal antibody, PBS Only (34064-1-PBS)

• 

  WB analysis using 34064-1-AP (same clone as 34064-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 34064-1-AP (VPS9D1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 34064-1-PBS in a different storage buffer formulation.

VPS9D1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 34064-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

ATPBL, C16orf7, Protein ATP-BL, VPS9 domain-containing protein 1

---

Product Information

34064-1-PBS targets VPS9D1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag41163

  Product name: Recombinant human C16orf7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 300-393 aa of BC148701

  Sequence: YPAVSRAAAPAPGCCPPTPNPGSRRLRPSQSLHCMLSPPEPSAAPRPQDSPPTPPLQPGPVGSPSPLGDTASGLPDKDSSFEDLEQFLGTSERQ

• Full Name: chromosome 16 open reading frame 7
• Calculated Molecular Weight: 73 kDa
• Observed Molecular Weight: 73 kDa
• GenBank Accession Number: BC148701
• Gene Symbol: C16orf7
• Gene ID (NCBI): 9605
• RRID: AB_3743148
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9Y2B5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

VPS9 domain-containing protein 1 (VPS9D1) promotes tubular endosome formation by specifically activating Rab22A (PMID: 36762583). The long non-coding RNA VPS9D1-AS1 can be activated by CEBPB transcription factor and target VEGFA to activate its downstream pathway to promote colorectal cancer angiogenesis, which may suggest that VPS9D1-AS1 is critical for regulating colorectal cancer angiogenesis (PMID: 40371141).