CoraLite® Plus 488-conjugated VRK1 Recombinant monoclonal antibody

VRK1 Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL488-85598-2
Clone No.242978A1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

EC:2.7.11.1, Serine/threonine-protein kinase VRK1, Vaccinia-related kinase 1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-85598-2 targets VRK1 in IF/ICC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag27754

Product name: Recombinant human VRK1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 262-396 aa of BC103761

Sequence: EDNLKDPKYVRDSKIRYRENIASLMDKCFPEKNKPGEIAKYMETVKLLDYTEKPLYENLRDILLQGLKAIGSKDDGKLDLSVVENGGLKAKTITKKRKKEIEESKEPGVEDTEWSNTQTEEAIQTRSRTRKRVQK

Predict reactive species
Full Name vaccinia related kinase 1
Calculated Molecular Weight 396 aa, 45 kDa
Observed Molecular Weight 45-50 kDa
GenBank Accession NumberBC103761
Gene Symbol VRK1
Gene ID (NCBI) 7443
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ99986
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Vaccinia-related kinase 1 (VRK1) is a members of the vaccinia-related kinase (VRK) family of serine/threonine kinases and are principally localized in the nucleus. VRK1 was initially described as a kinase with homology to B1R, a vaccinia virus kinase required for viral DNA replication and the early phase of infection. It has been suggested that VRK1 was overexpressed in numerous human tumors, such as lung carcinomas, hepatocellular carcinoma, breast carcinomas, head and neck squamous cell carcinoma. (PMID: 28927264, PMID: 29103766)

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 VRK1 antibody CL488-85598-2Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...