CoraLite® Plus 488-conjugated VRK1 Recombinant monoclonal antibody

• 

  IF Staining of HeLa using CL488-85598-2

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CoraLite® Plus 488 VRK1 antibody (CL488-85598-2, Clone: 242978A1 ) at dilution of 1:200, CL594-Phalloidin (red).

VRK1 Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-85598-2

Clone No.242978A1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Synonyms

EC:2.7.11.1, Serine/threonine-protein kinase VRK1, Vaccinia-related kinase 1

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-85598-2 targets VRK1 in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag27754

  Product name: Recombinant human VRK1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 262-396 aa of BC103761

  Sequence: EDNLKDPKYVRDSKIRYRENIASLMDKCFPEKNKPGEIAKYMETVKLLDYTEKPLYENLRDILLQGLKAIGSKDDGKLDLSVVENGGLKAKTITKKRKKEIEESKEPGVEDTEWSNTQTEEAIQTRSRTRKRVQK

• Full Name: vaccinia related kinase 1
• Calculated Molecular Weight: 396 aa, 45 kDa
• Observed Molecular Weight: 45-50 kDa
• GenBank Accession Number: BC103761
• Gene Symbol: VRK1
• Gene ID (NCBI): 7443
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q99986
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Vaccinia-related kinase 1 (VRK1) is a members of the vaccinia-related kinase (VRK) family of serine/threonine kinases and are principally localized in the nucleus. VRK1 was initially described as a kinase with homology to B1R, a vaccinia virus kinase required for viral DNA replication and the early phase of infection. It has been suggested that VRK1 was overexpressed in numerous human tumors, such as lung carcinomas, hepatocellular carcinoma, breast carcinomas, head and neck squamous cell carcinoma. (PMID: 28927264, PMID: 29103766)