VSIG1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• VSIG1 Polyclonal antibody, PBS Only (14145-1-PBS)

• 

  WB analysis of human stomach using 14145-1-AP (same clone as 14145-1-PBS)

  human stomach tissue were subjected to SDS PAGE followed by western blot with 14145-1-AP (VSIG1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14145-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human stomach using 14145-1-AP (same clone as 14145-1-PBS)

  human stomach tissue were subjected to SDS PAGE followed by western blot with 14145-1-AP (VSIG1 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14145-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach using 14145-1-AP (same clone as 14145-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 14145-1-AP (VSIG1 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14145-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 14145-1-AP (same clone as 14145-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 14145-1-AP (VSIG1 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 14145-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 14145-1-AP (same clone as 14145-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 14145-1-AP (VSIG1 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 14145-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 14145-1-AP (same clone as 14145-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 14145-1-AP (VSIG1 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 14145-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach using 14145-1-AP (same clone as 14145-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 14145-1-AP (VSIG1 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 14145-1-PBS in a different storage buffer formulation.

VSIG1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 14145-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

V-set and immunoglobulin domain-containing protein 1, GPA34, Glycoprotein A34, Cell surface A33 antigen

---

Product Information

14145-1-PBS targets VSIG1 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5314

  Product name: Recombinant human VSIG1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 256-387 aa of BC043216

  Sequence: FARNKAKAKAKERNSKTIAELEPMTKINPRGESEAMPREDATQLEVTLPSSIHETGPDTIQEPDYEPKPTQEPAPEPAPGSEPMAVPDLDIELELEPETQSELEPEPEPEPESEPGVVVEPLSEDEKGVVKA

• Full Name: V-set and immunoglobulin domain containing 1
• Calculated Molecular Weight: 387 aa, 42 kDa
• Observed Molecular Weight: 65-70 kDa
• GenBank Accession Number: BC043216
• Gene Symbol: VSIG1
• Gene ID (NCBI): 340547
• RRID: AB_2272980
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86XK7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.