VSIG10 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• VSIG10 Polyclonal antibody, PBS Only (33200-1-PBS)

• 

  WB analysis using 33200-1-AP (same clone as 33200-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 33200-1-AP ( VSIG10 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 33200-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 33200-1-AP (same clone as 33200-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 33200-1-AP ( VSIG10 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 33200-1-PBS in a different storage buffer formulation.

VSIG10 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 33200-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, Indirect ELISA

Synonyms

V-set and immunoglobulin domain-containing protein 10, VSIG10

---

Product Information

33200-1-PBS targets VSIG10 in WB, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37432

  Product name: Recombinant human FLJ20674 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 31-250 aa of BC034471

  Sequence: VVIGEVHENVTLHCGNISGLRGQVTWYRNNSEPVFLLSSNSSLRPAEPRFSLVDATSLHIESLSLGDEGIYTCQEILNVTQWFQVWLQVASGPYQIEVHIVATGTLPNGTLYAARGSQVDFSCNSSSRPPPVVEWWFQALNSSSESFGHNLTVNFFSLLLISPNLQGNYTCLALNQLSKRHRKVTTELLVYYPPPSAPQCWAQMASGSFMLQLTCRWDGG

• Full Name: hypothetical protein FLJ20674
• Calculated Molecular Weight: 60 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC034471
• Gene Symbol: FLJ20674
• Gene ID (NCBI): 54621
• RRID: AB_3742892
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8N0Z9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

VSIG10 (V-set and immunoglobulin domain containing 10) is a protein-coding gene located on human chromosome 12q24.23 that encodes a transmembrane protein belonging to the immunoglobulin superfamily. VSIG10 is a protein whose expression is altered in response to SARS-CoV-2 infection, making it a novel candidate biomarker for COVID-19.