VSTM1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• VSTM1 Polyclonal antibody, PBS Only (24382-1-PBS)

• 

  WB analysis using 24382-1-AP (same clone as 24382-1-PBS)

  human peripheral blood leukocytes were subjected to SDS PAGE followed by western blot with 24382-1-AP (VSTM1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24382-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HL-60 using 24382-1-AP (same clone as 24382-1-PBS)

  HL-60 cells were subjected to SDS PAGE followed by western blot with 24382-1-AP (VSTM1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24382-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 24382-1-AP (same clone as 24382-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 24382-1-AP (VSTM1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24382-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 24382-1-AP (same clone as 24382-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 24382-1-AP (VSTM1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24382-1-PBS in a different storage buffer formulation.

VSTM1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 24382-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

24382-1-PBS targets VSTM1 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15799

  Product name: Recombinant human VSTM1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 14-140 aa of BC100942

  Sequence: CLGYEDEKKNEKPPKPSLHAWPSSVVEAESNVTLKCQAHSQNVTFVLRKVNDSGYKQEQSSAENEAEFPFTDLKPKDAGRYFCAYKTTASHEWSESSEHLQLVVTDKHDELEAPSMKTDTRTIFVAI

• Full Name: V-set and transmembrane domain containing 1
• Calculated Molecular Weight: 236 aa, 26 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC100942
• Gene Symbol: VSTM1
• Gene ID (NCBI): 284415
• RRID: AB_2879516
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6UX27
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

VSTM1 (V-set and transmembrane domain-containing protein 1) has two main splicing isoform, VSTM1-v1 and VSTM1-v2. VSTM1-v1 is a type I membrane molecule, mainly expressed on human peripheral blood granulocytes and monocytes. VSTM1-v2 is a classical secretory glycoprotein mainly expressed in immune tissues, and can promote the differentiation and activation of Th17 cells. (PMID: 22960280; 23909423)