Vitronectin/S-protein Monoclonal antibody

• 

  WB analysis of human plasma using 66398-1-Ig

  human plasma were subjected to SDS PAGE followed by western blot with 66398-1-Ig (VTN Antibody) at dilution of 1:40000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of pig plasma using 66398-1-Ig

  pig plasma were subjected to SDS PAGE followed by western blot with 66398-1-Ig (VTN Antibody) at dilution of 1:40000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rabbit serum using 66398-1-Ig

  rabbit serum were subjected to SDS PAGE followed by western blot with 66398-1-Ig (VTN Antibody) at dilution of 1:40000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human testis using 66398-1-Ig

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 66398-1-Ig (VTN Antibody) at dilution of 1:350 (under 10x lens).

• 

  IHC staining of human testis using 66398-1-Ig

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 66398-1-Ig (VTN Antibody) at dilution of 1:200 (under 40x lens).

• 

  IHC staining of human liver using 66398-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 66398-1-Ig (VTN Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human liver using 66398-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 66398-1-Ig (VTN Antibody) at dilution of 1:200 (under 40x lens).

• 

  IF Staining of NIH/3T3 using 66398-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed NIH/3T3 cells using VTN antibody (66398-1-Ig, Clone: 1D2C8 ) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red).

Vitronectin/S-protein Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66398-1-Ig

Clone No.1D2C8

Publications(3)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, pig, rabbit

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

1D2C8, Serum-spreading factor, Somatomedin-B, S-protein, V75

---

Tested Applications

• Positive WB detected in: human plasma tissue, pig plasma tissue, rabbit serum tissue
• Positive IHC detected in: human testis tissue, human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: NIH/3T3 cells

Recommended dilution

• Western Blot (WB): WB : 1:10000-1:50000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

66398-1-Ig targets Vitronectin/S-protein in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, pig, rabbit samples.

• Tested Reactivity: human, mouse, pig, rabbit
• Cited Reactivity: human, mouse, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8443

  Product name: Recombinant human VTN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 126-478 aa of BC005046

  Sequence: EVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRAMWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL

• Full Name: vitronectin
• Calculated Molecular Weight: 478 aa, 54 kDa
• Observed Molecular Weight: 65 kDa
• GenBank Accession Number: BC005046
• Gene Symbol: VTN
• Gene ID (NCBI): 7448
• RRID: AB_2881772
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P04004
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Vitronectin is a glycoprotein present in blood and in the extracellular matrix (PMID: 10399314). Vitronectin is a multifunctional glycoprotein that mediates cell-to-substrate adhesion, inhibits the cytolytic action of the terminal complement cascade in vitro and binds to several serine protease inhibitors of the serpin family (PMID: 1372588).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
pig	IHC	Int J Mol Sci; Large-Scale Protein Analysis of Experimental Retinal Artery Occlusion; Authors - Nanna Vestergaard
human	WB	NPJ Biofilms Microbiomes; Clostridium difficile-derived membrane vesicles promote fetal growth restriction via inhibiting trophoblast motility through PPARγ/RXRα/ANGPTL4 axis; Authors - Zhiqiang Zha
mouse	IF	Int J Mol Sci; Using Cancer-Associated Fibroblasts as a Shear-Wave Elastography Imaging Biomarker to Predict Anti-PD-1 Efficacy of Triple-Negative Breast Cancer; Authors - Zhiming Zhang