Vitronectin/S-protein Monoclonal antibody, PBS Only

• 

  WB analysis of human plasma using 66398-1-Ig (same clone as 66398-1-PBS)

  human plasma were subjected to SDS PAGE followed by western blot with 66398-1-Ig (VTN Antibody) at dilution of 1:40000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66398-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig plasma using 66398-1-Ig (same clone as 66398-1-PBS)

  pig plasma were subjected to SDS PAGE followed by western blot with 66398-1-Ig (VTN Antibody) at dilution of 1:40000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66398-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rabbit serum using 66398-1-Ig (same clone as 66398-1-PBS)

  rabbit serum were subjected to SDS PAGE followed by western blot with 66398-1-Ig (VTN Antibody) at dilution of 1:40000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66398-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 66398-1-Ig (same clone as 66398-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 66398-1-Ig (VTN Antibody) at dilution of 1:350 (under 10x lens). This data was developed using the same antibody clone with 66398-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 66398-1-Ig (same clone as 66398-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 66398-1-Ig (VTN Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 66398-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 66398-1-Ig (same clone as 66398-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 66398-1-Ig (VTN Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 66398-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 66398-1-Ig (same clone as 66398-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 66398-1-Ig (VTN Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 66398-1-PBS in a different storage buffer formulation.

• 

  IF Staining of NIH/3T3 using 66398-1-Ig (same clone as 66398-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed NIH/3T3 cells using VTN antibody (66398-1-Ig, Clone: 1D2C8 ) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 66398-1-PBS in a different storage buffer formulation.

Vitronectin/S-protein Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 66398-1-PBS

Clone No.1D2C8

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, pig, rabbit

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

1D2C8, Serum-spreading factor, Somatomedin-B, S-protein, V75

---

Product Information

66398-1-PBS targets Vitronectin/S-protein in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, pig, rabbit samples.

• Tested Reactivity: human, mouse, pig, rabbit
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8443

  Product name: Recombinant human VTN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 126-478 aa of BC005046

  Sequence: EVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRAMWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL

• Full Name: vitronectin
• Calculated Molecular Weight: 478 aa, 54 kDa
• Observed Molecular Weight: 65 kDa
• GenBank Accession Number: BC005046
• Gene Symbol: VTN
• Gene ID (NCBI): 7448
• RRID: AB_2881772
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P04004
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Vitronectin is a glycoprotein present in blood and in the extracellular matrix (PMID: 10399314). Vitronectin is a multifunctional glycoprotein that mediates cell-to-substrate adhesion, inhibits the cytolytic action of the terminal complement cascade in vitro and binds to several serine protease inhibitors of the serpin family (PMID: 1372588).