CoraLite® Plus 488-conjugated VWF Recombinant monoclonal antibody

VWF Uni-rAb® Recombinant Antibody for IF-P
Cat No. CL488-83854-2
Clone No.240867D10

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

IF-P

VWF, VWFpp, F8VWF, von Willebrand antigen II, VWD

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inhuman tonsillitis tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-83854-2 targets VWF in IF-P applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag25578

Product name: Recombinant human vwf protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 754-854 aa of

Sequence: MSSPLSHRSKRSLSCRPPMVKLVCPADNLRAEGLECTKTCQNYDLECMSMGCVSGCLCPPGMVRHENRCVALERCPCFHQGKEYAPGETVKIGCNTCVCQD

Predict reactive species
Full Name von Willebrand factor
Observed Molecular Weight309-320 kDa
Gene Symbol VWF
Gene ID (NCBI) 7450
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP04275
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Von Willebrand factor (VWF) is a large multimeric glycoprotein found in blood plasma involved in hemostasis following vascular injury. Due to the multimeric nature of VWF, it can range in size from 500 to 20,000 kDa due to the differences in the number of subunits comprising the protein. Each subunit is approximately 250 kDa (PMID: 9759493). The biosynthesis of VWF in vivo is limited to endothelial cells (PMID: 4209883) and megakaryocytes (PMID: 2413071). VWF synthesized in endothelial cells is either released directly into the plasma via 27186a secretory pathway, or tubulized and stored in organelles unique to this cell type called Weibel-Palade bodies (PMID: 16459301). Whereas VWF synthesized in megakaryocytes is stored in the alpha granules of platelets (PMID: 2046403). The primary function of VWF is as an adhesive plasma glycoprotein, particularly factor VIII; an essential blood-clotting protein (PMID: 6982084). VWF is also important in platelet adhesion to wound sites by binding specifically to type I and type III collagen (PMID: 11098050), with larger VWF multimers being most effective (PMID: 24448155).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 VWF antibody CL488-83854-2Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...