Serpin A12/Vaspin Monoclonal antibody

• 

  WB analysis using 67573-1-Ig

  Human adipose tissue were subjected to SDS PAGE followed by western blot with 67573-1-Ig (Vaspin antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human placenta using 67573-1-Ig

  human placenta tissue were subjected to SDS PAGE followed by western blot with 67573-1-Ig (Vaspin antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HeLa using 67573-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using Vaspin antibody (67573-1-Ig, Clone: 2A1B6 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1).

Serpin A12/Vaspin Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 67573-1-Ig

Clone No.2A1B6

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

SERPINA12, SERPINA12/Vaspin, Vaspin, 2A1B6, OL 64

---

Tested Applications

• Positive WB detected in: human adipose tissue, human placenta tissue
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67573-1-Ig targets Serpin A12/Vaspin in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30136

  Product name: Recombinant human SERPINA12 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 275-370 aa of BC040857

  Sequence: PDEGKLKHLEKGLQVDTFSRWKTLLSRRVVDVSVPRLHMTGTFDLKKTLSYIGVSKIFEEHGDLTKIAPHRSLKVGEAVHKAELKMDERGTEGAAG

• Full Name: serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 12
• Calculated Molecular Weight: 414 aa, 47 kDa
• Observed Molecular Weight: 47 kDa
• GenBank Accession Number: BC040857
• Gene Symbol: Vaspin
• Gene ID (NCBI): 145264
• RRID: AB_2882786
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q8IW75
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SERPINA12 is also named as Serpin A12 and Visceral adipose tissue-derived serine protease inhibitor (Vaspin). Vaspin is an adipokine belonging to the serpin family, thus also named SERPINA12, with targets in kallikrein 7 and 14 that participates in skin desquamation (PMID: 34359881). Vaspin is a compensatory molecule in obesity and insulin resistance (PMID: 18321232). Vaspin is a newly described adipokine with an insulin sensitizing effect and inhibitory impact on food intake (PMID: 16030142, PMID: 21465327).