Vitamin D binding protein Monoclonal antibody

• 

  WB analysis of human testis using 66175-1-Ig

  human testis tissue were subjected to SDS PAGE followed by western blot with 66175-1-Ig (Vitamin D binding protein antibody at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon cancer using 66175-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66175-1-Ig (Vitamin D binding protein antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 66175-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 66175-1-Ig (Vitamin D binding protein antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 66175-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66175-1-Ig (Vitamin D binding protein antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 66175-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using Vitamin D binding protein antibody (66175-1-Ig, Clone: 1E4D10 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1), CL594-Phalloidin (red).

• 

  FC experiment of U-937 using 66175-1-Ig

  1X10^6 U-937 cells were intracellularly stained with 0.4 ug Anti-Human Vitamin D binding protein (66175-1-Ig, Clone:1E4D10) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

Vitamin D binding protein Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 66175-1-Ig

Clone No.1E4D10

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

Synonyms

GC, VDBP,GC, DBP, DBP/GC, DBP-maf

---

Tested Applications

• Positive WB detected in: human testis tissue
• Positive IHC detected in: human liver tissue, human colon cancer tissue, human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells
• Positive FC (Intra) detected in: U-937 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66175-1-Ig targets Vitamin D binding protein in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9803

  Product name: Recombinant human VDBP,GC protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 120-474 aa of BC057228

  Sequence: KLCMAALKHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLVSYTKSYLSMVGSCCTSASPTVCFLKERLQLKHLSLLTTLSNRVCSQYAAYGEKKSRLSNLIKLAQKVPTADLEDVLPLAEDITNILSKCCESASEDCMAKELPEHTVKLCDNLSTKNSKFEDCCQEKTAMDVFVCTYFMPAAQLPELPDVELPTNKDVCDPGNTKVMDKYTFELSRRTHLPEVFLSKVLEPTLKSLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQELCADYSENTFTEYKKKLAERLKAKLPDATPTELAKLVNKRSDFASNCCSINSPPLYCDSEIDAELKNIL

• Full Name: group-specific component (vitamin D binding protein)
• Calculated Molecular Weight: 474 aa, 53 kDa
• Observed Molecular Weight: 52-58 kDa
• GenBank Accession Number: BC057228
• Gene Symbol: Vitamin D binding protein
• Gene ID (NCBI): 2638
• RRID: AB_2881570
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P02774
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Vitamin D binding protein is a sparsely glycosylated serum protein responsible for highly specific binding and tissue-specific delivery of vitamin D and its metabolites. In addition, it is also an actin scavenger, and is the precursor to the immunomodulatory protein, Gc-MAF. Vitamin D binding protein has been proposed to have significant roles in C5a chemotaxis, osteoclast development and possibly in macrophage activation/recruitment.