WASP Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84714-2-RR (same clone as 84714-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84714-2-RR (WASP antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84714-2-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84714-2-RR

  Biolayer interferometry (BLl) kinetic assays of 84714-2-RR against Human WASP were performed. The affinity constant is 1.88 nM.

WASP Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 84714-2-PBS

Clone No.242074E4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

242074E4, Actin nucleation-promoting factor WAS, WAS, Wiskott-Aldrich syndrome protein

---

Product Information

84714-2-PBS targets WASP in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1444

  Product name: Recombinant human WAS protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-163 aa of BC012738

  Sequence: MSGGPMGGRPGGRGAPAVQQNIPSTLLQDHENQRLFEMLGRKCLTLATAVVQLYLALPPGAEHWTKEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYSQLVYSTPTPFFHTFAGDDCQAGLNFADEDEAQAFRALVQEKIQKRNQRQSGDRRQLPPPP

• Full Name: Wiskott-Aldrich syndrome (eczema-thrombocytopenia)
• Calculated Molecular Weight: 53 kDa
• Observed Molecular Weight: 58 kDa
• GenBank Accession Number: BC012738
• Gene Symbol: WASP
• Gene ID (NCBI): 7454
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P42768
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Wiskott-Aldrich Syndrome protein (WASP) regulates actin cytoskeleton in hematopoietic cells and defects in WASP cause Wiskott-Aldrich Syndrome (WAS), an X-linked immunodeficiency and autoimmunity disorder of childhood.