WASF1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• WASF1 Polyclonal antibody, PBS Only (32584-1-PBS)

• 

  WB analysis using 32584-1-AP (same clone as 32584-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32584-1-AP (WASF1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32584-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 32584-1-AP (same clone as 32584-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32584-1-AP (WASF1 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32584-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HEK-293 using 32584-1-AP (same clone as 32584-1-PBS)

  IP result of anti-WASF1 (IP:32584-1-AP, 4ug; Detection:32584-1-AP 1:3000) with HEK-293 cells lysate 1800 ug. This data was developed using the same antibody clone with 32584-1-PBS in a different storage buffer formulation.

WASF1 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 32584-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, Indirect ELISA

Synonyms

Actin-binding protein WASF1, KIAA0269, Protein WAVE-1, SCAR1, Verprolin homology domain-containing protein 1

---

Product Information

32584-1-PBS targets WASF1 in WB, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38505

  Product name: Recombinant human WASF1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 180-320 aa of NM_003931.2

  Sequence: KQKNLDRPHEPEKVPRAPHDRRREWQKLAQGPELAEDDANLLHKHIEVANGPASHFETRPQTYVDHMDGSYSLSALPFSQMSELLTRAEERVLVRPHEPPPPPPMHGAGDAKPIPTCISSATGLIENRPQSPATGRTPVFV

• Full Name: WAS protein family, member 1
• Calculated Molecular Weight: 62kDa，559aa
• Observed Molecular Weight: 75 kDa
• GenBank Accession Number: NM_003931.2
• Gene Symbol: WASF1
• Gene ID (NCBI): 8936
• RRID: AB_3742662
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q92558
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

WASF1 (Wiskott-Aldrich Syndrome Protein Family Member 1) is a gene encoding an actin-binding protein that belongs to the Wiskott-Aldrich syndrome protein family. It is primarily involved in regulating the reorganization of the actin cytoskeleton in cells, and is essential for processes such as cell morphology, motility, and signaling. WASF1 promotes actin polymerization by interacting with the Arp2/3 complex, thereby affecting cell deformation and migration. WASF1 is expressed in a variety of cell types, including tissues such as brain and testis. Its aberrant expression is associated with a variety of diseases, such as tumor invasion and metastasis.