WASF2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• WASF2 Polyclonal antibody, PBS Only (31442-1-PBS)

• 

  WB analysis using 31442-1-AP (same clone as 31442-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31442-1-AP (WASF2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31442-1-PBS in a different storage buffer formulation.

• 

  WB analysis of U2OS using 31442-1-AP (same clone as 31442-1-PBS)

  WB result of WASF2 antibody (31442-1-AP; 1:4000; incubated at room temperature for 1.5 hours) with sh-Control and sh-WASF2 transfected U2OS cells. This data was developed using the same antibody clone with 31442-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 31442-1-AP (same clone as 31442-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 31442-1-AP (WASF2 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31442-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 31442-1-AP (same clone as 31442-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed U2OS cells using WASF2 antibody (31442-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 31442-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

WASF2 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 31442-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

Protein WAVE 2, SCAR2, WAS protein family, member 2, WASP family protein member 2, WAVE2

---

Product Information

31442-1-PBS targets WASF2 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35663

  Product name: Recombinant human WASF2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 182-315 aa of NM_006990.4

  Sequence: KKDNPNRGNVNPRKIKTRKEEWEKMKMGQEFVESKEKLGTSGYPPTLVYQNGSIGCVENVDASSYPPPPQSDSASSPSPSFSEDNLPPPPAEFSYPVDNQRGSGLAGPKRSSVVSPSHPPPAPPLGSPPGPKPG

• Full Name: WAS protein family, member 2
• Calculated Molecular Weight: 54kDa，498aa
• Observed Molecular Weight: 80 kDa
• GenBank Accession Number: NM_006990.4
• Gene Symbol: WASF2
• Gene ID (NCBI): 10163
• RRID: AB_3669985
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9Y6W5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

WASF2 (WASp family Verprolin-homologous protein-2), also known as WAVE2, a member of the Wiskott-Aldrich syndrome protein (WASp) family of actin nucleation promoting factors, is a downstream effector molecule that implicates the signal transduction from small GTPases to the actin cytoskeleton, which can elongate the cell movement mode (PMID: 35849030,28332566). Moreover, WASF2 promoted the invasiveness of cancer cells by binding to actin cytoskeletal protein alpha-actinin 4 (ACTN4) (PMID: 30353690). The calculated MW of WASF2 is 54 kDa, with an isoform of 32 kDa, but the observed MW is about 80 kDa, which may be due to post-translational modification (PMID: 35849030,28332566,21383498,17389688,18362183,38391912).