WASF3 Monoclonal antibody, PBS Only

• 

  WB analysis using 67620-1-Ig (same clone as 67620-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67620-1-Ig (WASF3 antibody) at dilution of 1:40000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67620-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67620-1-Ig (same clone as 67620-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67620-1-Ig (WASF3 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67620-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67620-1-Ig (same clone as 67620-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67620-1-Ig (WASF3 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67620-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67620-1-Ig (same clone as 67620-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67620-1-Ig (WASF3 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67620-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67620-1-Ig (same clone as 67620-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67620-1-Ig (WASF3 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67620-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 67620-1-Ig (same clone as 67620-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using WASF3 antibody (67620-1-Ig, Clone: 3B7D10 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67620-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human liver cancer using 67620-1-Ig (same clone as 67620-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human liver cancer tissue using WASF3 antibody (67620-1-Ig, Clone: 3B7D10 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). DAPI (blue). This data was developed using the same antibody clone with 67620-1-PBS in a different storage buffer formulation.

WASF3 Monoclonal Antibody for IHC, IF-P, Indirect ELISA

Cat No. 67620-1-PBS

Clone No.3B7D10

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse, Rat, Pig, Rabbit

Applications

IHC, IF-P, Indirect ELISA

Synonyms

Brush 1, KIAA0900, Protein WAVE 3, SCAR3, WAS protein family, member 3, WASF3, WASP family protein member 3, WAVE3

---

Product Information

67620-1-PBS targets WASF3 in IHC, IF-P, Indirect ELISA applications and shows reactivity with Human, Mouse, Rat, Pig, Rabbit samples.

• Tested Reactivity: Human, Mouse, Rat, Pig, Rabbit
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29991

  Product name: Recombinant human WASF3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 212-391 aa of BC050283

  Sequence: GIEFMSDAKKLEQAGSAKEDRVPSGSHASDVTDYSYPATPNHSLHPQPVTPSYAAGDVPPHGPASQAAEHEYRPPSASARHMALNRPQQPPPPPPPQAPEGSQASAPMAPADYGMLPAQIIEYYNPSGPPPPPPPPVIPSAQTAFVSPLQMPMQPPFPASASSTHAAPPHPPSTGLLVTA

• Full Name: WAS protein family, member 3
• Calculated Molecular Weight: 55 kDa
• Observed Molecular Weight: 50-55 and 66-70 kDa
• GenBank Accession Number: BC050283
• Gene Symbol: WASF3
• Gene ID (NCBI): 10810
• RRID: AB_2882822
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9UPY6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

WASF3, also named WAVE3 or SCAR3, belongs to the SCAR/WAVE family. It plays a role in the regulation of cell morphology and cytoskeletal organization. WASF3 is associated with movement, invasion, and metastasis in different cancers such as breast cancer, gastric cancer, and prostate cancer. It has been shown that WASF3 levels are elevated in advanced-stage cancers compared to lower-grade tumors and normal tissue. The 67620-1-Ig antibody recognizes 50-55 kDa and 66-70 kDa proteins similar to the papers.(PMID: 21544801, 15826941, 31038356, 27432794, 31542393)