WASF3 Monoclonal antibody, PBS Only

WASF3 Monoclonal Antibody for IHC, IF-P, Indirect ELISA
Cat No. 67620-1-PBS
Clone No.3B7D10

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse, Rat, Pig, Rabbit

Applications

IHC, IF-P, Indirect ELISA

Brush 1, KIAA0900, Protein WAVE 3, SCAR3, WAS protein family, member 3, WASF3, WASP family protein member 3, WAVE3

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67620-1-PBS targets WASF3 in IHC, IF-P, Indirect ELISA applications and shows reactivity with Human, Mouse, Rat, Pig, Rabbit samples.

Tested Reactivity Human, Mouse, Rat, Pig, Rabbit
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag29991

Product name: Recombinant human WASF3 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 212-391 aa of BC050283

Sequence: GIEFMSDAKKLEQAGSAKEDRVPSGSHASDVTDYSYPATPNHSLHPQPVTPSYAAGDVPPHGPASQAAEHEYRPPSASARHMALNRPQQPPPPPPPQAPEGSQASAPMAPADYGMLPAQIIEYYNPSGPPPPPPPPVIPSAQTAFVSPLQMPMQPPFPASASSTHAAPPHPPSTGLLVTA

Predict reactive species
Full Name WAS protein family, member 3
Calculated Molecular Weight 55 kDa
Observed Molecular Weight 50-55 and 66-70 kDa
GenBank Accession NumberBC050283
Gene Symbol WASF3
Gene ID (NCBI) 10810
RRIDAB_2882822
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9UPY6
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

WASF3, also named WAVE3 or SCAR3, belongs to the SCAR/WAVE family. It plays a role in the regulation of cell morphology and cytoskeletal organization. WASF3 is associated with movement, invasion, and metastasis in different cancers such as breast cancer, gastric cancer, and prostate cancer. It has been shown that WASF3 levels are elevated in advanced-stage cancers compared to lower-grade tumors and normal tissue. The 67620-1-Ig antibody recognizes 50-55 kDa and 66-70 kDa proteins similar to the papers.(PMID: 21544801, 15826941, 31038356, 27432794, 31542393)

Loading...
||
New chat Able
正在加载,请稍候...