WASF3 Monoclonal antibody

WASF3 Monoclonal Antibody for IHC, IF-P, ELISA
Cat No. 67620-1-Ig
Clone No.3B7D10

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse, Rat, Pig, Rabbit

Applications

IHC, IF-P, ELISA

Brush 1, KIAA0900, Protein WAVE 3, SCAR3, WAS protein family, member 3, WASF3, WASP family protein member 3, WAVE3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 647
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inhuman liver cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse brain tissue, human liver cancer tissue

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67620-1-Ig targets WASF3 in IHC, IF-P, ELISA applications and shows reactivity with Human, Mouse, Rat, Pig, Rabbit samples.

Tested Reactivity Human, Mouse, Rat, Pig, Rabbit
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag29991

Product name: Recombinant human WASF3 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 212-391 aa of BC050283

Sequence: GIEFMSDAKKLEQAGSAKEDRVPSGSHASDVTDYSYPATPNHSLHPQPVTPSYAAGDVPPHGPASQAAEHEYRPPSASARHMALNRPQQPPPPPPPQAPEGSQASAPMAPADYGMLPAQIIEYYNPSGPPPPPPPPVIPSAQTAFVSPLQMPMQPPFPASASSTHAAPPHPPSTGLLVTA

Predict reactive species
Full Name WAS protein family, member 3
Calculated Molecular Weight 55 kDa
Observed Molecular Weight 50-55 and 66-70 kDa
GenBank Accession NumberBC050283
Gene Symbol WASF3
Gene ID (NCBI) 10810
RRIDAB_2882822
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9UPY6
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

WASF3, also named WAVE3 or SCAR3, belongs to the SCAR/WAVE family. It plays a role in the regulation of cell morphology and cytoskeletal organization. WASF3 is associated with movement, invasion, and metastasis in different cancers such as breast cancer, gastric cancer, and prostate cancer. It has been shown that WASF3 levels are elevated in advanced-stage cancers compared to lower-grade tumors and normal tissue. The 67620-1-Ig antibody recognizes 50-55 kDa and 66-70 kDa proteins similar to the papers.(PMID: 21544801, 15826941, 31038356, 27432794, 31542393)

Protocols

Product Specific Protocols
IF protocol for WASF3 antibody 67620-1-IgDownload protocol
IHC protocol for WASF3 antibody 67620-1-IgDownload protocol
WB protocol for WASF3 antibody 67620-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...