WBP4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• WBP4 Polyclonal antibody, PBS Only (32283-1-PBS)

• 

  WB analysis using 32283-1-AP (same clone as 32283-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32283-1-AP (WBP4 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32283-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 32283-1-AP (same clone as 32283-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 32283-1-AP (WBP4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 32283-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U-251 using 32283-1-AP (same clone as 32283-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed U-251 cells using WBP4 antibody (32283-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red). This data was developed using the same antibody clone with 32283-1-PBS in a different storage buffer formulation.

WBP4 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 32283-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

FBP21, FNBP21, Formin-binding protein 21, WBP-4, WW domain-binding protein 4

---

Product Information

32283-1-PBS targets WBP4 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35400

  Product name: Recombinant human WBP4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-150 aa of BC108310

  Sequence: MADYWKSQPKKFCDYCKCWIADNRPSVEFHERGKNHKENVAKRISEIKQKSLDKAKEEEKASKEFAAMEAAALKAYQEDLKRLGLESEILEPSITPVTSTIPPTSTSNQQKEKKEKKKRKKDPSKGRWVEGITSEGYHYYYDLISGASQW

• Full Name: WW domain binding protein 4 (formin binding protein 21)
• Observed Molecular Weight: 50-55 kDa
• GenBank Accession Number: BC108310
• Gene Symbol: WBP4
• Gene ID (NCBI): 11193
• RRID: AB_3742568
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: O75554
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

WW domain-binding protein 4 (WBP4), formerly known as FBP21, is a 376-amino acid spliceosomal protein containing a zinc finger motif and two tandem WW domains. It is a member of the WW domain-containing protein family, which plays a role in various cellular processes including signal transduction, transcriptional regulation and protein degradation. The protein is characterised by its WW domains, which mediate interactions with proline-rich motifs in other proteins. WBP4 is involved in key signalling pathways such as Wnt and Notch and interacts with transcription factors and components of the ubiquitin-proteasome system.