WDHD1 Polyclonal antibody

• 

  WB analysis using 33739-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33739-1-AP (WDHD1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

WDHD1 Polyclonal Antibody for WB, ELISA

Cat No. 33739-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

AND1

---

Tested Applications

• Positive WB detected in: A431 cells, A549 cells, Calu-1 cells, MCF-7 cells, MDA-MB-231 cells, NIH/3T3 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33739-1-AP targets WDHD1 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38697

  Product name: Recombinant human WDHD1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 950-1129 aa of NM_007086.3

  Sequence: SRTTNNEKSPIIKPLIPKPKPKQASAASYFQKRNSQTNKTEEVKEENLKNVLSETPAICPPQNTENQRPKTGFQMWLEENRSNILSDNPDFSDEADIIKEGMIRFRVLSTEERKVWANKAKGETASEGTEAKKRKRVVDESDETENQEEKAKENLNLSKKQKPLDFSTNQKLSAFAFKQE*

• Full Name: WD repeat and HMG-box DNA binding protein 1
• Calculated Molecular Weight: 126kDa，1129aa
• Observed Molecular Weight: 126 kDa
• GenBank Accession Number: NM_007086.3
• Gene Symbol: WDHD1
• Gene ID (NCBI): 11169
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: O75717
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The WD repeat and HMG-box DNA-binding protein 1 (WDHD1), also known as acidic nucleoplasmic DNA-binding protein 1 (AND-1), is a DNA‐binding protein with a total molecular weight of 126 kDa, containing multiple N-terminal WD40 domains and a C-terminal high mobility group (HMG) box. WDHD1 contains the highly conserved SepB domain, which plays a crucial role in DNA replication processes(PMID: 37569867). WDHD1 regulates the assembly and activation of the pre‐replication complex (pre-RC), and WDHD1 depletion leads to G1 stagnation and delays progression to the S phase(PMID: 36345604).