WDR1 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• WDR1 Monoclonal antibody (67937-1-Ig)

• Featured Product
• KD/KO Validated

WDR1 Monoclonal Antibody for WB, ELISA

Cat No. 67937-1-Ig Copied!

Clone No. 2D11E1

Publications (1)

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, rat

Applications

WB, ELISA

Synonyms

WD repeat containing protein 1, NORI-1, NORI 1, AIP1, Actin-interacting protein 1

• 

  WB analysis using 67937-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67937-1-Ig (WDR1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 67937-1-Ig

  WB result of WDR1 antibody (67937-1-Ig; 1:10000; incubated at room temperature for 1.5 hours) with sh-Control and sh-WDR1 transfected HEK-293 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat testis using 67937-1-Ig

  rat testis tissue were subjected to SDS PAGE followed by western blot with 67937-1-Ig (WDR1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for WDR1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A549 cells, rat testis tissue, HEK-293 cells, U-87 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67937-1-Ig targets WDR1 in WB, ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30967

  Product name: Recombinant human WDR1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-350 aa of BC030541

  Sequence: MPYEIKKVFASLPQVERGVSKIIGGDPKGNNFLYTNGKCVILRNIDDHSRFVNCVRFSPDGNRFATASADGQIYIYDGKTGEKVCALGGSKAHDGGIYAISWSPDSTHLLSASGDKTSKIWDVSVNSVVSTFPMGSTVLDQQLGCLWQKDHLLSVSLSGYINYLDRNNPSKPLHVIKGHSKSIQCLTVHKNGGKSYIYSGSHDGHINYWDSETGENDSFAGKGHTNQVSRMTVDESGQLISCSMDDTVRYTSLMLRDYSGQGVVKLDVQPKCVAVGPGGYAVVVCIGQIVLLKDQRKCFSIDNPGYEPEVVAVHPGGDTVAIGGVDGNVRLYSILGTTLKDEGKLLEAKG

• Full Name: WD repeat domain 1
• Calculated Molecular Weight: 606 aa, 66 kDa
• Observed Molecular Weight: 65-66 kDa
• GenBank Accession Number: BC030541
• Gene Symbol: WDR1
• Gene ID (NCBI): 9948
• RRID: AB_2918689
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O75083
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

WDR1, which belongs to the WD repeat AIP1 family, also known as AIP1, is a 606 amino acid protein that localizes to the cytoskeleton. WD repeats are approximately 30- to 40-amino acid domains containing several conserved residues, mostly including a trp-asp at the C-terminal end. WDR1 induces the disassembly of actin filaments in conjunction with ADF/cofilin family proteins (PMID:15629458, 27557945, 29751004). WDR1 mutations may impair the ability of WDR1 to regulate cofilin-mediated actin depolymerization, and are associated with periodic fever, immunodeficiency, and thrombocytopenia syndrome (PMID: 27557945,27994071,29751004).

Publications

What published studies show

The WDR1 Monoclonal antibody (2D11E1), catalog number 67937-1-Ig, has 1 total citation. The cited publication appeared in Acta Physiol (Oxf) (2023). The research focuses on hypertrophic scar fibrosis and metabolic remodeling, specifically investigating how the adipose-derived stem cell peptide ADSCP2 binds pyruvate carboxylase to alleviate fibrosis. WDR1 was detected by Western blot in human samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Acta Physiol (Oxf); The adipose-derived stem cell peptide ADSCP2 alleviates hypertrophic scar fibrosis via binding with pyruvate carboxylase and remodeling the metabolic landscape; Authors - Jingyun Li