WDR1 Monoclonal antibody, PBS Only

• 

  WB analysis using 67937-1-Ig (same clone as 67937-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67937-1-Ig (WDR1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67937-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 67937-1-Ig (same clone as 67937-1-PBS)

  WB result of WDR1 antibody (67937-1-Ig; 1:10000; incubated at room temperature for 1.5 hours) with sh-Control and sh-WDR1 transfected HEK-293 cells. This data was developed using the same antibody clone with 67937-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat testis using 67937-1-Ig (same clone as 67937-1-PBS)

  rat testis tissue were subjected to SDS PAGE followed by western blot with 67937-1-Ig (WDR1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67937-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

WDR1 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 67937-1-PBS

Clone No.2D11E1

Host / Isotype

Mouse / IgG1

Reactivity

human, rat

Applications

WB, Indirect ELISA

Synonyms

WD repeat containing protein 1, NORI-1, NORI 1, AIP1, Actin-interacting protein 1

---

Product Information

67937-1-PBS targets WDR1 in WB, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30967

  Product name: Recombinant human WDR1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-350 aa of BC030541

  Sequence: MPYEIKKVFASLPQVERGVSKIIGGDPKGNNFLYTNGKCVILRNIDDHSRFVNCVRFSPDGNRFATASADGQIYIYDGKTGEKVCALGGSKAHDGGIYAISWSPDSTHLLSASGDKTSKIWDVSVNSVVSTFPMGSTVLDQQLGCLWQKDHLLSVSLSGYINYLDRNNPSKPLHVIKGHSKSIQCLTVHKNGGKSYIYSGSHDGHINYWDSETGENDSFAGKGHTNQVSRMTVDESGQLISCSMDDTVRYTSLMLRDYSGQGVVKLDVQPKCVAVGPGGYAVVVCIGQIVLLKDQRKCFSIDNPGYEPEVVAVHPGGDTVAIGGVDGNVRLYSILGTTLKDEGKLLEAKG

• Full Name: WD repeat domain 1
• Calculated Molecular Weight: 606 aa, 66 kDa
• Observed Molecular Weight: 65-66 kDa
• GenBank Accession Number: BC030541
• Gene Symbol: WDR1
• Gene ID (NCBI): 9948
• RRID: AB_2918689
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O75083
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

WDR1, which belongs to the WD repeat AIP1 family, also known as AIP1, is a 606 amino acid protein that localizes to the cytoskeleton. WD repeats are approximately 30- to 40-amino acid domains containing several conserved residues, mostly including a trp-asp at the C-terminal end. WDR1 induces the disassembly of actin filaments in conjunction with ADF/cofilin family proteins (PMID:15629458, 27557945, 29751004). WDR1 mutations may impair the ability of WDR1 to regulate cofilin-mediated actin depolymerization, and are associated with periodic fever, immunodeficiency, and thrombocytopenia syndrome (PMID: 27557945,27994071,29751004).