Tested Applications
| Positive WB detected in | HEK-293T cells, HeLa cells, Jurkat cells, U-251 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
31440-1-AP targets WDR21A in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag35426 Product name: Recombinant human WDR21A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-120 aa of BC018979 Sequence: MNKSRWQSRRRHGRRSHQQNPWFRLRDSEDRSDSRAAQPAHDSGHGDDESPSTSSGTAGTSSVPELPGFYFDPEKKRYFRLLPGHNNCNPLTKESIRQKEMESKRLRLLQEEDRRKKIAR Predict reactive species |
| Full Name | WD repeat domain 21A |
| Observed Molecular Weight | 55 kDa |
| GenBank Accession Number | BC018979 |
| Gene Symbol | WDR21A |
| Gene ID (NCBI) | 26094 |
| RRID | AB_3669984 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q8WV16 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
WDR21A, also known as DCAF4 (DDB1 and CUL4 associated factor 4), is a WD repeat-containing protein that functions as a substrate receptor for the CUL4-DDB1 E3 ubiquitin-protein ligase complex, playing a crucial role in the ubiquitination and subsequent regulation of specific target proteins within the cell. Characterized by its WD40 repeat domain which facilitates protein-protein interactions, WDR21A is involved in critical biological processes such as cell population proliferation and post-translational protein modification. Structural studies have revealed that WDR21A interacts with the DDB1 adaptor protein via a distinct H-box motif, and multiple alternatively spliced transcript variants have been identified for this gene, underscoring its regulatory complexity.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for WDR21A antibody 31440-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

