WDR21A Polyclonal antibody

• Home
• Products
• Primary Antibodies
• WDR21A Polyclonal antibody (31440-1-AP)

• 

  WB analysis using 31440-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31440-1-AP (WDR21A antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

WDR21A Polyclonal Antibody for WB, ELISA

Cat No. 31440-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

WDR21, WD repeat domain 21A, DCAF4

---

Tested Applications

• Positive WB detected in: HEK-293T cells, HeLa cells, Jurkat cells, U-251 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31440-1-AP targets WDR21A in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35426

  Product name: Recombinant human WDR21A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-120 aa of BC018979

  Sequence: MNKSRWQSRRRHGRRSHQQNPWFRLRDSEDRSDSRAAQPAHDSGHGDDESPSTSSGTAGTSSVPELPGFYFDPEKKRYFRLLPGHNNCNPLTKESIRQKEMESKRLRLLQEEDRRKKIAR

• Full Name: WD repeat domain 21A
• Observed Molecular Weight: 55 kDa
• GenBank Accession Number: BC018979
• Gene Symbol: WDR21A
• Gene ID (NCBI): 26094
• RRID: AB_3669984
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8WV16
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.