Product Information
31440-1-PBS targets WDR21A in WB, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag35426 Product name: Recombinant human WDR21A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-120 aa of BC018979 Sequence: MNKSRWQSRRRHGRRSHQQNPWFRLRDSEDRSDSRAAQPAHDSGHGDDESPSTSSGTAGTSSVPELPGFYFDPEKKRYFRLLPGHNNCNPLTKESIRQKEMESKRLRLLQEEDRRKKIAR Predict reactive species |
| Full Name | WD repeat domain 21A |
| Observed Molecular Weight | 55 kDa |
| GenBank Accession Number | BC018979 |
| Gene Symbol | WDR21A |
| Gene ID (NCBI) | 26094 |
| RRID | AB_3669984 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q8WV16 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
WDR21A, also known as DCAF4 (DDB1 and CUL4 associated factor 4), is a WD repeat-containing protein that functions as a substrate receptor for the CUL4-DDB1 E3 ubiquitin-protein ligase complex, playing a crucial role in the ubiquitination and subsequent regulation of specific target proteins within the cell. Characterized by its WD40 repeat domain which facilitates protein-protein interactions, WDR21A is involved in critical biological processes such as cell population proliferation and post-translational protein modification. Structural studies have revealed that WDR21A interacts with the DDB1 adaptor protein via a distinct H-box motif, and multiple alternatively spliced transcript variants have been identified for this gene, underscoring its regulatory complexity.

