WDR33 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• WDR33 Polyclonal antibody, PBS Only (22614-1-PBS)

• 

  WB analysis of HepG2 using 22614-1-AP (same clone as 22614-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 22614-1-AP (WDR33 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22614-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 22614-1-AP (same clone as 22614-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 22614-1-AP (WDR33 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22614-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 22614-1-AP (same clone as 22614-1-PBS)

  IP result of anti-WDR33 (IP:22614-1-AP, 4ug; Detection:22614-1-AP 1:1000) with HeLa cells lysate 3200ug. This data was developed using the same antibody clone with 22614-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovarian cancer using 22614-1-AP (same clone as 22614-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovarian cancer slide using 22614-1-AP (WDR33 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22614-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 22614-1-AP (same clone as 22614-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using WDR33 antibody (22614-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red). This data was developed using the same antibody clone with 22614-1-PBS in a different storage buffer formulation.

WDR33 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 22614-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

pre-mRNA 3' end processing protein WDR33, WD repeat-containing protein 33, WD repeat-containing protein of 146 kDa, WDR 33

---

Product Information

22614-1-PBS targets WDR33 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18382

  Product name: Recombinant human WDR33 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-239 aa of BC010283

  Sequence: GRREESFRRGAPPRHEGRAPPRGRDGFPGPEDFGPEENFDASEEAARGRDLRGRGRGTPRGGRKGLLPTPDEFPRFEGGRKPDSWDGNREPGPGHEHFRDTPRPDHPPHDGHSPASRERSSSLQGMDMASLPPRKRPWHDGPGTSEHREMEAPGGPSEDRGGKGRGGPGPAQRVPKSGRSSSLDGEHHDGYHRDEPFGGPPGSGTPSRGGRSGSNWGRGSNMNSGPPRRGASRGGGRGR

• Full Name: WD repeat domain 33
• Calculated Molecular Weight: 1336 aa, 146 kDa
• Observed Molecular Weight: 170 kDa
• GenBank Accession Number: BC010283
• Gene Symbol: WDR33
• Gene ID (NCBI): 55339
• RRID: AB_2879135
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q9C0J8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

WD repeat domain 33 (WDR33), also named WDC146, is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene is highly expressed in testis and the protein is localized to the nucleus. This gene may play important roles in the mechanisms of cytodifferentiation and/or DNA recombination.This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene is highly expressed in testis and the protein is localized to the nucleus. This gene may play important roles in the mechanisms of cytodifferentiation and/or DNA recombination. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. This antibody recognizes the full length WDR33 protein.