WDR36 Polyclonal antibody

• 

  WB analysis using 23126-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 23126-1-AP (WDR36 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse liver using 23126-1-AP

  IP result of anti-WDR36 (IP:23126-1-AP, 4ug; Detection:23126-1-AP 1:500) with mouse liver tissue lysate 1840 ug.

WDR36 Polyclonal Antibody for WB, IP, ELISA

Cat No. 23126-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IP, ELISA

Synonyms

GLC1G, TA WDRP, TAWDRP, UTP21, WD repeat domain 36, WDR36

---

Tested Applications

• Positive WB detected in: HEK-293 cells, L02 cells
• Positive IP detected in: mouse liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

23126-1-AP targets WDR36 in WB, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19425

  Product name: Recombinant human WDR36 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 602-938 aa of BC136517

  Sequence: FSISVLDIETRKIVREFSGHQGQINDMAFSPDGRWLISAAMDCSIRTWDLPSGCLIDCFLLDSAPLNVSMSPTGDFLATSHVDHLGIYLWSNISLYSVVSLRPLPADYVPSIVMLPGTCQTQDVEVSEETVEPSDELIEYDSPEQLNEQLVTLSLLPESRWKNLLNLDVIKKKNKPKEPPKVPKSAPFFIPTIPGLVPRYAAPEQNNDPQQSKVVNLGVLAQKSDFCLKLEEGLVNNKYDTALNLLKESGPSGIETELRSLSPDCGGSIEVMQSFLKMIGMMLDRKRDFELAQAYLALFLKLHLKMLPSEPVLLEEITNLSSQVEENWTHLQSLFNQ

• Full Name: WD repeat domain 36
• Calculated Molecular Weight: 951 aa, 105 kDa
• Observed Molecular Weight: 99-105 kDa
• GenBank Accession Number: BC136517
• Gene Symbol: WDR36
• Gene ID (NCBI): 134430
• RRID: AB_3669407
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q8NI36
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.