WDR36 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• WDR36 Polyclonal antibody, PBS Only (23126-1-PBS)

• 

  WB analysis using 23126-1-AP (same clone as 23126-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 23126-1-AP (WDR36 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23126-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse liver using 23126-1-AP (same clone as 23126-1-PBS)

  IP result of anti-WDR36 (IP:23126-1-AP, 4ug; Detection:23126-1-AP 1:500) with mouse liver tissue lysate 1840 ug. This data was developed using the same antibody clone with 23126-1-PBS in a different storage buffer formulation.

WDR36 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 23126-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IP, Indirect ELISA

Synonyms

---

Product Information

23126-1-PBS targets WDR36 in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19425

  Product name: Recombinant human WDR36 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 602-938 aa of BC136517

  Sequence: FSISVLDIETRKIVREFSGHQGQINDMAFSPDGRWLISAAMDCSIRTWDLPSGCLIDCFLLDSAPLNVSMSPTGDFLATSHVDHLGIYLWSNISLYSVVSLRPLPADYVPSIVMLPGTCQTQDVEVSEETVEPSDELIEYDSPEQLNEQLVTLSLLPESRWKNLLNLDVIKKKNKPKEPPKVPKSAPFFIPTIPGLVPRYAAPEQNNDPQQSKVVNLGVLAQKSDFCLKLEEGLVNNKYDTALNLLKESGPSGIETELRSLSPDCGGSIEVMQSFLKMIGMMLDRKRDFELAQAYLALFLKLHLKMLPSEPVLLEEITNLSSQVEENWTHLQSLFNQ

• Full Name: WD repeat domain 36
• Calculated Molecular Weight: 951 aa, 105 kDa
• Observed Molecular Weight: 99-105 kDa
• GenBank Accession Number: BC136517
• Gene Symbol: WDR36
• Gene ID (NCBI): 134430
• RRID: AB_3669407
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q8NI36
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.