WDR42A Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• WDR42A Polyclonal antibody, PBS Only (33500-1-PBS)

• 

  WB analysis using 33500-1-AP (same clone as 33500-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 33500-1-AP (WDR42A antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 33500-1-PBS in a different storage buffer formulation.

WDR42A Polyclonal Antibody for WB, Indirect ELISA

Cat No. 33500-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

DCAF8, DDB1- and CUL4-associated factor 8, H326, WD repeat-containing protein 42A

---

Product Information

33500-1-PBS targets WDR42A in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38765

  Product name: Recombinant human WDR42A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-100 aa of BC099709

  Sequence: MSSKGSSTDGRTDLANGSLSSSPEEMSGAEEGRETSSGIEVEASDLSLSLTGDDGGPNRTSTESRGTDTESSGEDKDSDSMEDTGHYSINDENRVHDRSE

• Full Name: WD repeat domain 42A
• Calculated Molecular Weight: 597 aa, 67 kDa
• Observed Molecular Weight: 67-73 kDa
• GenBank Accession Number: BC099709
• Gene Symbol: WDR42A
• Gene ID (NCBI): 50717
• RRID: AB_3742993
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q5TAQ9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

WD repeat-containing protein 42A (WDR42A), also named DDB1- and CUL4- associated factor 8 (DCAF8), is a member of the WD40-repeat proteins (PMID: 22500989). WDR42A is a nucleocytoplasmic shuttling protein. WDR42A acts as a substrate receptor for the CUL4-DDB1 E3 ubiquitin-protein ligase complex, which is involved in protein ubiquitination (Uniprot).