WDR48 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• WDR48 Polyclonal antibody (16503-1-AP)

• Featured Product
• KD/KO Validated

WDR48 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 16503-1-AP Copied!

Publications (11)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, CoIP, ELISA

Synonyms

KIAA1449, p80, UAF1, USP1 associated factor 1, USP1-associated factor 1

• 

  WB analysis using 16503-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16503-1-AP (WDR48 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HEK-293 using 16503-1-AP

  IP result of anti-WDR48 (IP:16503-1-AP, 3ug; Detection:16503-1-AP 1:500) with HEK-293 cells lysate 3000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human intrahepatic cholangiocarcinoma using 16503-1-AP

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 16503-1-AP (WDR48 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse colon using 16503-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 16503-1-AP (WDR48 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human rectal cancer using 16503-1-AP

  Immunohistochemical analysis of paraffin-embedded human rectal cancer tissue slide using 16503-1-AP (WDR48 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 16503-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 16503-1-AP (WDR48 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse stomach using 16503-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 16503-1-AP (WDR48 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat stomach using 16503-1-AP

  Immunohistochemical analysis of paraffin-embedded rat stomach tissue slide using 16503-1-AP (WDR48 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for WDR48 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells, Jurkat cells, mouse heart tissue
• Positive IP detected in: HEK-293 cells
• Positive IHC detected in: human intrahepatic cholangiocarcinoma tissue, human stomach cancer tissue, rat stomach tissue, mouse stomach tissue, mouse colon tissue, human rectal cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16503-1-AP targets WDR48 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9674

  Product name: Recombinant human WDR48 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 158-502 aa of BC037168

  Sequence: RASGDYDNDCTNPITPLCTQPDQVIKGGASIIQCHILNDKRHILTKDTNNNVAYWDVLKACKVEDLGKVDFEDEIKKRFKMVYVPNWFSVDLKTGMLTITLDESDCFAAWVSAKDAGFSSPDGSDPKLNLGGLLLQALLEYWPRTHVNPMDEEENEVNHVNGEQENRVQKGNGYFQVPPHTPVIFGEAGGRTLFRLLCRDSGGETESMLLNETVPQWVIDITVDKNMPKFNKIPFYLQPHASSGAKTLKKDRLSASDMLQVRKVMEHVYEKIINLDNESQTTSSSNNEKPGEQEKEEDIAVLAEEKIELLCQDQVLDPNMDLRTVKHFIWKSGGDLTLHYRQKST

• Full Name: WD repeat domain 48
• Calculated Molecular Weight: 502aa,57 kDa; 677aa,76 kDa
• Observed Molecular Weight: 70-80 kDa
• GenBank Accession Number: BC037168
• Gene Symbol: WDR48
• Gene ID (NCBI): 57599
• RRID: AB_2878266
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TAF3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The WDR48 polyclonal antibody (Cat# 16503-1-AP) has 11 citations published in journals including Nature Cell Biology, Nature Communications, Cell Death & Differentiation, Journal of Biological Chemistry, iScience, Journal of Neuroscience, Cell Proliferation, Microbiology Spectrum, Cell Cycle, and Chinese Medical Journal. Research fields encompass DNA replication stress, Wnt/β-catenin signaling, tumor immunology, glioblastoma drug resistance, hepatocellular carcinoma, spermiogenesis, spinal cord injury, viral infection, protein degradation, and epithelial-mesenchymal transition.

Automatically generated from the 11 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Cell Biol; RPA exhaustion activates SLFN11 to eliminate cells with heightened replication stress; Authors - Tyler H Stanage
mouse,human	WB,IP	Nat Commun; The USP46 complex deubiquitylates LRP6 to promote Wnt/β-catenin signaling; Authors - Victoria H Ng
mouse	WB	Cell Death Differ; The USP1-WDR48 deubiquitinase complex functions as a molecular switch regulating tumor-associated macrophage activation and anti-tumor response; Authors - Dianwen Han
human	WB,IF,CoIP	Chin Med J (Engl); Epigenetically elevated RAD51AP1 regulates the RAD51-UAF1 complex contributing to temozolomide resistance in EGFRvIII glioblastoma; Authors - Yuanhao Chang
human	WB	Cell Prolif; Comprehensive analysis of ubiquitin-specific protease 1 reveals its importance in hepatocellular carcinoma.; Authors - Yalei Zhao
mouse	WB	iScience; The deubiquitinase cofactor UAF1 interacts with USP1 and plays an essential role in spermiogenesis; Authors - Ziqi Wang