CoraLite® Plus 488-conjugated WDR55 Polyclonal antibody

WDR55 Polyclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-20786

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra)

WD repeat-containing protein 55, WD repeat domain 55

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-20786 targets WDR55 in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag14241

Product name: Recombinant human WDR55 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 162-383 aa of BC002482

Sequence: MDMRQHEEYIADMALDPAKKLLLTASGDGCLGIFNIKRRRFELLSEPQSGDLTSVTLMKWGKKVACGSSEGTIYLFNWNGFGATSDRFALRAESIDCMVPVTESLLCTGSTDGVIRAVNILPNRVVGSVGQHTGEPVEELALSHCGRFLASSGHDQRLKFWDMAQLRAVVVDDYRRRKKKGGPLRALSSKTWSTDDFFAGLREEGEDSMAQEEKEETGDDSD

Predict reactive species
Full Name WD repeat domain 55
Calculated Molecular Weight 383 aa, 42 kDa
Observed Molecular Weight 42-50 kDa
GenBank Accession NumberBC002482
Gene Symbol WDR55
Gene ID (NCBI) 54853
RRIDAB_3672719
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9H6Y2
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

WD repeat domain 55 (WDR55) also named as, FLJ20195, is a 383 amino acid protein, which contains seven WD repeats and belongs to the WD repeat WDR55 family. WDR55 localizes in the nucleus and cytoplasm. WDR55 acts as a modulator of rRNA synthesis and play a central role in organogenesis.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 WDR55 antibody CL488-20786Download protocol
IF protocol for CL Plus 488 WDR55 antibody CL488-20786Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...