WDR74 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• WDR74 Recombinant monoclonal antibody (86361-2-RR)

• 

  WB analysis using 86361-2-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86361-2-RR (WDR74 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HeLa using 86361-2-RR

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using WDR74 antibody (86361-2-RR, Clone: 251046A3 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  Affinity and Kinetic Characterization of 86361-2-RR

  Biolayer interferometry (BLl) kinetic assays of 86361-2-RR against Human WDR74 were performed. The affinity constant is 1.02 nM.

WDR74 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 86361-2-RR

Clone No.251046A3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, ELISA

Synonyms

NSA1, WD repeat domain 74, WD repeat-containing protein 74

---

Tested Applications

• Positive WB detected in: HepG2 cells, MDA-MB-231 cells, A-673 cells, A375 cells, IMR-32 cells, RAW264.7 cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86361-2-RR targets WDR74 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag14617

  Product name: Recombinant human WDR74 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-300 aa of BC006351

  Sequence: MAAAAARWNHVWVGTETGILKGVNLQRKQAANFTAGGQPRREEAVSALCWGTGGETQMLVGCADRTVKHFSTEDGIFQGQRHCPGGEGMFRGLAQADGTLITCVDSGILRVWHDKDKDTSSDPLLELRVGPGVCRMRQDPAHPHVVATGGKENALKIWDLQGSEEPVFRAKNVRNDWLDLRVPIWDQDIQFLPGSQKLVTCTGYHQVRVYDPASPQRRPVLETTYGEYPLTAMTLTPGGNSVIVGNTHGQLAEIDLRQGRLLGCLKGLAGSVRGLQCHPSKPLLASCGLDRVLRIHRIQN

• Full Name: WD repeat domain 74
• Calculated Molecular Weight: 385 aa, 42 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC006351
• Gene Symbol: WDR74
• Gene ID (NCBI): 54663
• RRID: AB_3744838
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q6RFH5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

WDR74, also known as WD repeat domain 74, is a protein-coding gene that plays important roles in various biological processes. WDR74 is involved in rRNA processing and ribosomal large subunit biogenesis. It is a 60S ribosome assembly factor, which is irreplaceable in ribosome biogenesis and is closely related to protein synthesis. WDR74 can induce nuclear β-catenin accumulation and activate Wnt-responsive genes, thus promoting cell proliferation and metastasis in various cancers.