Use Able AI chat for product recommendations

CoraLite® Plus 488-conjugated WDR74 Recombinant monoclonal antibody

WDR74 Uni-rAb® Recombinant Antibody for IF/ICC

Cat No. CL488-86361-2
Clone No.251046A3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC

NOP seven associated protein 1, NOP seven-associated protein 1, NSA1, WD repeat domain 74, WD repeat-containing protein 74

Formulation:  PBS, Proclin300, BSA, Glycerol
PBS, Proclin300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-86361-2 targets WDR74 in IF/ICC applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag14617

Product name: Recombinant human WDR74 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-300 aa of BC006351

Sequence: MAAAAARWNHVWVGTETGILKGVNLQRKQAANFTAGGQPRREEAVSALCWGTGGETQMLVGCADRTVKHFSTEDGIFQGQRHCPGGEGMFRGLAQADGTLITCVDSGILRVWHDKDKDTSSDPLLELRVGPGVCRMRQDPAHPHVVATGGKENALKIWDLQGSEEPVFRAKNVRNDWLDLRVPIWDQDIQFLPGSQKLVTCTGYHQVRVYDPASPQRRPVLETTYGEYPLTAMTLTPGGNSVIVGNTHGQLAEIDLRQGRLLGCLKGLAGSVRGLQCHPSKPLLASCGLDRVLRIHRIQN

Predict reactive species
Full Name WD repeat domain 74
Calculated Molecular Weight 385 aa, 42 kDa
Observed Molecular Weight40 kDa
GenBank Accession NumberBC006351
Gene Symbol WDR74
Gene ID (NCBI) 54663
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ6RFH5
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

WDR74, also known as WD repeat domain 74, is a protein-coding gene that plays important roles in various biological processes. WDR74 is involved in rRNA processing and ribosomal large subunit biogenesis. It is a 60S ribosome assembly factor, which is irreplaceable in ribosome biogenesis and is closely related to protein synthesis. WDR74 can induce nuclear β-catenin accumulation and activate Wnt-responsive genes, thus promoting cell proliferation and metastasis in various cancers.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 WDR74 antibody CL488-86361-2Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...