WDR77 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• WDR77 Polyclonal antibody, PBS Only (10115-1-PBS)

• 

  WB analysis using 10115-1-AP (same clone as 10115-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10115-1-AP (WDR77 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10115-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach using 10115-1-AP (same clone as 10115-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 10115-1-AP (WDR77 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10115-1-PBS in a different storage buffer formulation.

WDR77 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 10115-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

WDR 77, WD45, WD repeat-containing protein 77, Nbla10071, Methylosome protein WDR77

---

Product Information

10115-1-PBS targets WDR77 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0147

  Product name: Recombinant human WDR77 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 92-342 aa of BC001679

  Sequence: RGILVASDSGAVELWELDENETLIVSKFCKYEHDDIVSTVSVLSSGTQAVSGSKDICIKVWDLAQQVVLSSYRAHAAQVTCVAASPHKDSVFLSCSEDNRILLWDTRCPKPASQIGCSAPGYLPTSLAWHPQQSEVFVFGDENGTVSLVDTKSTSCVLSSAVHSQCVTGLVFSPHSVPFLASLSEDCSLAVLDSSLSELFRSQAHRDFVRDATWSPLNHSLLTTVGWDHQVVHHVVPTEPLPAPGPASVTE

• Full Name: WD repeat domain 77
• Calculated Molecular Weight: 50 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC001679
• Gene Symbol: WDR77
• Gene ID (NCBI): 79084
• RRID: AB_2215725
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BQA1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

WDR77, other named p44, MEP-50, is a component of the 20S PRMT5-containing methyltransferase complex, which modifies specific arginines to dimethylarginines in several spliceosomal Sm proteins. Normally, WDR77 locates in the nucleus, such as in prostate epithelial cells. However, it localized to the cytoplasm in prostatic intraepithelial neoplasia and prostate cancer cells. Nuclear WDR77 mediates the growth inhibition and differentiation. WDR may involve in the biogenesis of small nuclear ribonucleoprotein particles.