WDSOF1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• WDSOF1 Polyclonal antibody (33483-1-AP)

• 

  WB analysis using 33483-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33483-1-AP (WDSOF1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human ovary tumor using 33483-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 33483-1-AP (WDSOF1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of PC-3 using 33483-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed PC-3 cells using WDSOF1 antibody (33483-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

WDSOF1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 33483-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

DCAF13, DDB1 And CUL4 Associated Factor 13, DDB1- and CUL4-associated factor 13, HSPC064, WD repeat and SOF domain-containing protein 1

---

Tested Applications

• Positive WB detected in: NIH/3T3 cells
• Positive IHC detected in: human ovary tumor tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: PC-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33483-1-AP targets WDSOF1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35559

  Product name: Recombinant human WDSOF1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 249-597 aa of BC112042

  Sequence: TQRNCIRTIQAHEGFVRGICTRFCGTSFFTVGDDKTVKQWKMDGPGYGDEEEPLHTILGKTVYTGIDHHWKEAVFATCGQQVDIWDEQRTNPICSMTWGFDSISSVKFNPIETFLLGSCASDRNIVLYDMRQATPLKKVILDMRTNTICWNPMEAFIFTAANEDYNLYTFDMRALDTPVMVHMDHVSAVLDVDYSPTGKEFVSASFDKSIRIFPVDKSRSREVYHTKRMQHVICVKWTSDSKYIMCGSDEMNIRLWKANASEKLGVLTSREKAAKDYNQKLKEKFQHYPHIKRIARHRHLPKSIYSQIQEQRIMKEARRRKEVNRIKHSKPGSVPLVSEKKKHVVAVVK

• Full Name: WD repeats and SOF1 domain containing
• Calculated Molecular Weight: 597 aa, 67 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC112042
• Gene Symbol: WDSOF1
• Gene ID (NCBI): 25879
• RRID: AB_3742988
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9NV06
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

WDSOF1 (WD repeat and SOF1 domain-containing 1, also known as DCAF13) functions as a substrate receptor subunit for the CRL4-DDB1 E3 ubiquitin ligase complex. It contains WD40 repeat clusters and is primarily localized in the nucleolus, where it participates in the processing of 40S ribosomal RNA precursors and the regulation of the estrogen receptor. Recent research has revealed its indispensable role in uterine development: its deficiency leads to the downregulation of estrogen target genes, an increase in H3K9me3 levels, failure of embryo implantation, and complete infertility in female mice. Furthermore, WDSOF1 is located at 8q22.3, a genomic region frequently amplified in tumors. It is highly expressed in various cancers, including liver and breast cancer, and is associated with poor prognosis, positioning it as an oncogenic factor and a potential therapeutic target.